SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009362 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009362
Domain Number 1 Region: 211-379,406-454
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.36e-25
Family Eukaryotic proteases 0.0013
Further Details:      
 
Domain Number 2 Region: 68-130
Classification Level Classification E-value
Superfamily GLA-domain 4.21e-23
Family GLA-domain 0.00047
Further Details:      
 
Domain Number 3 Region: 179-223
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000381
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 4 Region: 120-151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000051
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009362   Gene: ENSTNIG00000006588   Transcript: ENSTNIT00000009533
Sequence length 472
Comment pep:novel chromosome:TETRAODON8:3:1193114:1195725:1 gene:ENSTNIG00000006588 transcript:ENSTNIT00000009533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVSSGSHERARGQKEVSVMAVGIMFAPARVCVLGLCLLGGLLQVLVQGEVFRMPHASSL
FLRSKRANAYLIEEILQGNLERECYEELCTYEEAREFFEDTKHTEAFWARYHDGNQCEPN
PCLHGGNCTDKREAFNCSCVAPFSGKTCELGARKPLPAASQSSRPGSPASDGLQCPTDGP
TACQQVCTAFYRTFKCSCMPGFKLQSDKRSCLPEVEFPCGSLPVTSNGSASMCPHGNCPW
QVSVVTSRGLELCGGVLLAPSAVLTAANCLHQLDDVQPRNLFVVPGNEKQYIPVASVNLH
DRFRSGDPDYDLPTKDFCEKVLMHSGTKGITKRRGAGQTQELGYLTLDQCRGQLNVSHRL
SNKMFCMRNKEAATGPDVLFDSFSKMEAGNSSKVQIAEAKPRRCTHLPPGTPVATVEQGT
AYLTGLVKSPSSDCDARLVFTKISRYLSWIKMKLEKLRNDITPQISQFPSPY
Download sequence
Identical sequences H3CM81
ENSTNIP00000009362 99883.ENSTNIP00000009362 ENSTNIP00000009362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]