SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009365 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009365
Domain Number 1 Region: 168-282
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.98e-32
Family Eukaryotic proteases 0.00079
Further Details:      
 
Domain Number 2 Region: 37-97
Classification Level Classification E-value
Superfamily GLA-domain 8.24e-23
Family GLA-domain 0.00037
Further Details:      
 
Domain Number 3 Region: 86-121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000104
Family EGF-type module 0.005
Further Details:      
 
Domain Number 4 Region: 126-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000209
Family EGF-type module 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009365   Gene: ENSTNIG00000006591   Transcript: ENSTNIT00000009536
Sequence length 282
Comment pep:novel chromosome:TETRAODON8:3:1182784:1185394:1 gene:ENSTNIG00000006591 transcript:ENSTNIT00000009536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTLVFTLVFTFSHPCAASVFLDADEAHDVLVRTRRYNSGWMEELQKGDLRRECLEEICSY
EEAREVFEHTETTDEFWKLYTRPDSCKSSPCLNGGSCSAEGPSYTCYCLPEFRGVNCELE
YRSVPDTCLVENGGCEHFCDEDAAGRRLNCSCADGYGLDADGLSCNAKEVVVCGKVLLTQ
LDSNRLNPRARIVGGDECPKGECPWQVLLVYKGKGFCGGVIYKPTWVLTASHCMEDIDVQ
FLTVVAGEHNTGLNEGTEQTILVSKVIMHERYVPSTADNDIA
Download sequence
Identical sequences H3CM84
ENSTNIP00000009365 ENSTNIP00000009365 99883.ENSTNIP00000009365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]