SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009409 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009409
Domain Number 1 Region: 139-265
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.08e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 2 Region: 8-152
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000643
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 3 Region: 265-397
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000091
Family Growth factor receptor domain 0.0062
Further Details:      
 
Domain Number 4 Region: 520-554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000036
Family EGF-type module 0.02
Further Details:      
 
Domain Number 5 Region: 487-521
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000376
Family EGF-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000009409
Domain Number - Region: 554-589
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000289
Family EGF-type module 0.062
Further Details:      
 
Domain Number - Region: 419-454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000311
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 455-484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00659
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009409   Gene: ENSTNIG00000006632   Transcript: ENSTNIT00000009580
Sequence length 650
Comment pep:novel chromosome:TETRAODON8:1:14284898:14288983:1 gene:ENSTNIG00000006632 transcript:ENSTNIT00000009580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLYLFNADVDECSLAAVTGLQACQDDALCGNTPGSFTCSCPTGYTMAQNGQSCVDIDE
CSLEQRCRPEFGNVCVNTPGSFVCQCQPGFRAQAPACGDVDECLESPAVCGDGPALCENT
LGSYKCVCPAGYQGNGTHCEDENECASGAHGCDPNARCGNIIGSYFCQCHQGFSGDGRSC
YDIDECAMNNARCEHNCSNESGGYSCQCAAGFRLDQDGHNCTDVDECLALSGTCEHLCIN
TQGSFQCSCRAGYQLHIDAHTCVDIDECKLHNGGCSHSCSNTVGGHVCHCPPPLLLAIDN
LTCSDVRSCKLRNGGCEHTCALTAEGRVRCSCRSGWKLDVDLRSCVDVNECGDFTNGGCE
QLCANHPGGFNCTCREGYSVRTDQLSRCQPVCDPPCNNYGVCIAPNSCDCPPGYPGPGCS
AMCSPPCAHGGTCMRWNKCLCPLGWTGAGCHTAVCDLPCANGGRCVGPNICQCPSDYSGP
QCLLPLCTPACQNGGRCVDVNKCTCAGGWQGARCQIELVQCQRPCRNGGVCAGFNRCRCA
RGFVGELCETAVTTPCVPPCQHGATCSPHNTCTCPEGTAGLRCQKLTCPVVTTVVSMARA
VRRAVRESYVDRCGPLGVQLCTKYRINQARVYLQAYRVGYKIQCPERRGR
Download sequence
Identical sequences H3CMC8
99883.ENSTNIP00000009409 ENSTNIP00000009409 ENSTNIP00000009409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]