SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009453 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009453
Domain Number 1 Region: 593-633
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000513
Family Ovomucoid domain III-like 0.005
Further Details:      
 
Domain Number 2 Region: 676-715
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000568
Family Ovomucoid domain III-like 0.028
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000009453
Domain Number - Region: 720-750
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000194
Family Ovomucoid domain III-like 0.012
Further Details:      
 
Domain Number - Region: 537-596
Classification Level Classification E-value
Superfamily FnI-like domain 0.000994
Family VWC domain 0.022
Further Details:      
 
Domain Number - Region: 763-793
Classification Level Classification E-value
Superfamily FnI-like domain 0.022
Family VWC domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009453   Gene: ENSTNIG00000006674   Transcript: ENSTNIT00000009626
Sequence length 927
Comment pep:novel chromosome:TETRAODON8:Un_random:87621232:87721914:1 gene:ENSTNIG00000006674 transcript:ENSTNIT00000009626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CCHHAAEFTPCKEACDQLATIKSESRLKHLLQRLPGYCPESMNDLWTCINSTLPGVSRKS
EGWVGLGCCELAISAECRRECRQASSRSDIIKVCKKLTENSLYSCITKNEMGSTCCSYAG
RHTTCREYCQAIFRTDSTPTSSQITAVTEYCQSHSAQLLACVANFTKSYPVRSPIDSLHC
CDRAEATHCQVACRRILRTMNTEHEIMEGLIQECGSQPLPQDPMWQCFLGSAHPPSPPEE
ETPHPAKMDCAKLHCCSKANTSLCRDMCQEVSTKWGSQTWQDFDQLCEYNPVETELTECL
ADVREPCQLGCKGLSYCTNFNNRPTELFRSCNVQSDQGAMSDFKLWSNGTIKMPYMNIPV
LDIRKCLPDMWKAVACSLQIKPCHIKSRGSLICKSDCVDILTQCGDRRRFHEGQTPERIC
ELLSPVDDPERCIPLHRYLGPSVLDSDRAEEVVHPCNPNPCPSNHVCQVNRRGCLDALRC
QPYICVPAGCKLGEASDFLVQLDARVQVPTRTGPAGCYEVCSCGPSGRLENCVEMPCLDI
HKPCVVGGQRRSPGSTFRVDCRLCSCLAGDSVCSRRRCLGSEGAQPQHLTGTCLPCDCPD
RFVPVCASNGRNYPSACVARCLGFQDHQFVFGTCGMGNTCSSKPCPRNQRCVPRHRVCLS
DSSACPQYECVGRPGVCDRNGGELACDTDGVVHLSVCHLQQAGKRLAYMGLCQEVCRKPQ
QVCGHNMETYNTVCHALADRVAVDYEGPCHAVGALSDGAPDSACSIVSCPPLSSPGCRPV
TPPGACCPICASMLQILWNKEAMNTFSKLNKNRPETVQDVLQVLRLHVSVPQCDVFGYLS
IDHMLVVLVAPVERQPTPLQMEACSKEAEKIDSLINHASPTLVSHVPLSAFLTSEIRTTS
VHSSGGCPPSPLRPGLCFLLGLLSAAP
Download sequence
Identical sequences H3CMH2
99883.ENSTNIP00000009453 ENSTNIP00000009453 ENSTNIP00000009453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]