SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009560 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009560
Domain Number 1 Region: 190-333
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000196
Family Growth factor receptor domain 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000009560
Domain Number - Region: 146-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0544
Family EGF-type module 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009560   Gene: ENSTNIG00000006773   Transcript: ENSTNIT00000009735
Sequence length 356
Comment pep:novel chromosome:TETRAODON8:19:5517961:5520045:-1 gene:ENSTNIG00000006773 transcript:ENSTNIT00000009735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SELRPLQLLSYLTVFLLVTLTDAKRDLKSACLTCQQITENFNKGFERTAKQNFGGGNTAW
EERKLSKYETSEIRLMEIVEGLCESSSFECNHMVEEHEEQLETWWFKRKTKHPDLHKWFC
IETIKVCCPKGTFGRDCNSCVGGSERPCHGNGVCDGDGTRGGDGKCSCNHGYTGEFCLDC
TDGHFSAARNDTFSLCTECHTSCKTCTGATNQDCHECKEGWREDDQEACVDVDECSGEPS
PCREDQYCLNADGSYSCRACDNVCSGCTGAGADRCQSCAGGYHRSEGTCADVDECSQSDP
VCTEDNQKCINTHGSYMCVCTGGYEEKDGKCVHTVPPVEEENSEASEVTSDPHGEL
Download sequence
Identical sequences H3CMS9
99883.ENSTNIP00000009560 ENSTNIP00000009560 ENSTNIP00000009560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]