SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009712 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009712
Domain Number 1 Region: 27-201
Classification Level Classification E-value
Superfamily TIMP-like 2.35e-67
Family Tissue inhibitor of metalloproteinases, TIMP 0.00000345
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009712   Gene: ENSTNIG00000006915   Transcript: ENSTNIT00000009888
Sequence length 214
Comment pep:novel chromosome:TETRAODON8:19:6376854:6385242:1 gene:ENSTNIG00000006915 transcript:ENSTNIT00000009888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSMYQHLISLLFVCSSLHVNHLTEGCSCALTHPQDAFCNSDIVIRAKVVGKKPLRDGPF
GTMRYTVKQMKMYKGFDKVQHVQHIYTDASESLCGVKFDINKYQYLITGRVYDGKVYTGL
CNFNMRWERLSLAQKKGFNHRYQLGCNCRIKSCHYLPCFVTSKNECLWTDMLSHFGYPGY
QSRHYACIQQKEGYCSWYRGMTGRDKTTINATDP
Download sequence
Identical sequences Q4SSS5
99883.ENSTNIP00000009712 ENSTNIP00000009712 ENSTNIP00000009712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]