SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009823 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009823
Domain Number 1 Region: 22-133
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.83e-31
Family Cap-Gly domain 0.0000304
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000009823
Domain Number - Region: 951-1057
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00262
Family Hemolysin E (HlyE, ClyA, SheA) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009823   Gene: ENSTNIG00000007023   Transcript: ENSTNIT00000010001
Sequence length 1281
Comment pep:novel chromosome:TETRAODON8:Un_random:616625:624262:1 gene:ENSTNIG00000007023 transcript:ENSTNIT00000010001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGRRHSYTPRLTSPLISKMSSAGTVESGKAPKIGSVVEVIGKGQRGTVAYIGATLFAA
GKWVGVILNEPKGKNDGTVQGKRYFTCEENHGIFVRQSQIQVVDDGSAATSPDIPESGLA
KTLKQKGECVPQTGCFYTLSFQKFPRLQNHSSSSPPPPQPPIRRSTKASRESLPSALPGA
VSEAAAAPTQGAPSAPQPSTPAPAAAPAPATPSKEEESLRAQVKDQEEKLETLKMKRNED
KAKLKELEKYKIQLEQLQEWKNKMQEQQAEIQKQLKEAKKEAREAQEAKDRYMEEMSDTA
DAIEMATLDKEMAEERAESLQVEVDSLKEKVDELSMDLEILRHEISEKGTGSDGAASSYH
VKQLEEQNSRLKEALVRMRDLSSSEKQEHTKLQKQMEKKNSELETLRSQKEKLQEELKQA
EATVDELKEQVDAALGSEEMVETLTERNLDLEERVRELRETVTDLEAINEMNDELQENAR
ETEMELREQLDLSGARVREADKRVEAAQETVADYQQTISKYRELTTRLQEANKDLLSQQN
ASAEQLQQPPAELFDFKIKFAETKAHAKAIEMELRKVEVAQLNKQVALLTSFMPDSFLRH
GGDHDCILVLLLIPRLICKAELIGKQAEEKFELSGTSAPARGLRGAPGEQRSFASGLVYS
LNLLQATLHKYEQALNTCGVDVLRRMGTLCSEMSFHERSLDYFIDLLHKDQLDETVQVEP
LTKAIKYYQQLYSVHLAEQTEDCTVQLADHIKFSQSALDCMAVEVARLRAFLAAGQESSS
LAVLLKDLDTSCSDVRQFCKKIRRRMPGTDVVGVPAALSFGPQVAETLSECRRQLTRVVA
VLQEVAAAGAQMIAPLAEQEGLSALKLEDIACKAVEQVYGSLGQSGTECLRQSCASIITT
MNKMATAMQEGEYDADKPPTKTPPVEVRASSVRAEMTDAEGLGVKLEDRETVIKELKKSL
KIKGEELSEASVRLSLLEKKLDTSTKDADERVEKIQTRLDENLALLKKKEKEFEETMDAL
QADIDQLEAEKAELKQRIANQSKMTIEGLVSRGVASSNTAAAAAQGPAGGSGARTRGLPP
SLAGSLQVVDSPLLRQQVEAQRLGLKHLKNENNRLKAEKMRAQLASLPPLRPAKLPPVPR
DGSAPPGGPNTGIYRRTDQLLATLLKLSADVRVVDVTGKTAVSAGAQLLEQTARLQNLSD
ALDKLKGEVAEHVVSHRPGAKAPSDFATFPVSSFIKAKEEKQGGTRLVGRVSIPCCPGQE
QVHRLVLSPQQLQQVHRLLAA
Download sequence
Identical sequences H3CNJ1
ENSTNIP00000009823 ENSTNIP00000009823 99883.ENSTNIP00000009823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]