SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009825 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009825
Domain Number 1 Region: 350-532
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-66
Family SPRY domain 0.0000102
Further Details:      
 
Domain Number 2 Region: 8-80
Classification Level Classification E-value
Superfamily RING/U-box 4.86e-18
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 3 Region: 134-199
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.11e-16
Family B-box zinc-binding domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009825   Gene: ENSTNIG00000007025   Transcript: ENSTNIT00000010003
Sequence length 545
Comment pep:novel chromosome:TETRAODON8:Un_random:632159:635023:-1 gene:ENSTNIG00000007025 transcript:ENSTNIT00000010003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMSSTVSLSEEQFRCLVCQDVFCEPVSIPCGHSFCFSCITWHWESAGLSCPKCRAVFDAR
PELCENSFAKEMCEKIRLRRPRGSSPATKGFIYCDVCTGKRSKAVKSCLACLASYCQSHL
EPHLRVATLRIHKLIPPVAMLEKRICKQHQRLLELYCRTDRSCVCVLCTESKHQGHLTVP
VERESQEKQAQMRRTQEDVEQMIQERLQKVGQLRRCLELSKQNSKRDVMRSVEVFAALRR
SMEKRERELVQSIQRKQAAAEERAERLIEELELEVSELERRRSEMEQLCHTEDHLHFLER
FPALCSTSAPSCSDIFVHPDTCLGAVRRAVAHMERQLQSFSQSFALQDHEQLQQYAADVH
LDPNTAHPWLALSEDRRQVWDGGQRRDLVDTPERFDTAPCVLGSKGFTTGRHYWEVDVGD
KPAWDLGVARQSVDRKGVVTLSPEDGFWSVCLRGGSEYRACAGEAELLALPRKPRVIGVF
LDFEDGTVSFYDAGAQSHIYSFTDYQFSEAMFPFLNPDISDSSANQSPLTIRTIGTSRDL
DHFTI
Download sequence
Identical sequences H3CNJ3
ENSTNIP00000009825 ENSTNIP00000009825 99883.ENSTNIP00000009825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]