SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009890 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009890
Domain Number 1 Region: 164-255
Classification Level Classification E-value
Superfamily TAFH domain-like 4.45e-33
Family TAFH domain-like 0.0000075
Further Details:      
 
Domain Number 2 Region: 439-487
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000184
Family TBP-associated factors, TAFs 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009890   Gene: ENSTNIG00000007089   Transcript: ENSTNIT00000010068
Sequence length 652
Comment pep:novel chromosome:TETRAODON8:11:2728066:2731830:1 gene:ENSTNIG00000007089 transcript:ENSTNIT00000010068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RALTPQVLAPRLPLTSPGQPSVHNIQIPPGMVLIQSESGQLLLIPQQALAQMQAQAQGGV
AARTATPTNASPGQVSFSQATGNTVVSKPVAPSTIIHPGCAAPTSLPVTTTLHRPPVLQA
PGKVADFILFPLYLVVSISGASGTVPRTVNKTAGTTVTTIAMSKETIENVKKCKNFLSTL
MKLASTGKQSPETAALVRELVKDLLDGKLEAEEFTSRLYKELNSSPQPYLVPFLMRSLPA
LRQLTPDSTAFIQQSQLPQPASAPVTSASAISSTVVLSSPAPRLPVPVSRPQFQPGVTKP
GQSTSLVLQPQQQRAVLGPQVTLATTPMVTLRNPAPSHIVLGQQRVQLKDLQPAIFTKVV
LRPPGSVRQPGSKQASAPALTPSQRNQLKEAGGTFKDDDDINDVASMAGVNLSEESANIL
ATNSELVGVVTRSCKDEAFLSASLLQRRMLEIGRRFGVTDLGAEVVKYVSHAAQQRLQSL
LEKVSLVAQQRHISFKEDERYEQDGDVRAQLKFFEQLDQLEKQRKEEQEREILLKAAKSR
SRQEDPEQLRLKQKAKEMQQQELAQLRQREANLTALAAIGPRKKRKFLDSPSSSSAEGSG
PGPCLSSSAVSGSRPVRQRITRVNLRDLLFCLENERFTSRSHFLYKSFLNPG
Download sequence
Identical sequences H3C9F2
ENSTNIP00000009890 99883.ENSTNIP00000004874 ENSTNIP00000004874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]