SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009938 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009938
Domain Number 1 Region: 171-309
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.52e-19
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 19-69,117-172
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000973
Family Growth factor receptor domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000009938
Domain Number - Region: 298-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000974
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009938   Gene: ENSTNIG00000007137   Transcript: ENSTNIT00000010117
Sequence length 458
Comment pep:novel chromosome:TETRAODON8:10:11942077:11948298:1 gene:ENSTNIG00000007137 transcript:ENSTNIT00000010117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WPGRKRMLAALISILLCIQPGRGQTCTQGFEFDPRARQCVDVDECRLLQDACRGDMRCVN
QNGGYLCLPRGLYNQQYAQDPQEPYYPDTSDGFADRFLPGPPRSAEPSYPVIRTSAQCVL
GYALTEDGTCNDIDECETNSHHCNPTQVCINTAGGYTCSCTEGYWLIGGQCQGGFSGADI
DECRYGYCQQLCANVPGSFSCSCNRGFVLDPEGRTCQDVNECLEQPCSHSCFNTYGSFIC
SCEEGFELTSDGTSCIDLDECSFSEFLCQHRCVNAPGSFTCICPPGYYVYEDNRNCEDIN
ECDTGNNTCTTEQVCFNFQGGYTCLNPLQCPPPYIEVSDNQCMCSVENPACRDKPFSILY
RHMDLSSGRSVPADIFQMQATTRYPGAFYIFQIRSGNDGREFYMRQTSNLSATLVLSRPI
RGPREVVLDLEMVTINNVINFRGSSIIRLTIFVSAHPF
Download sequence
Identical sequences H3CNV5
99883.ENSTNIP00000009938 ENSTNIP00000009938 ENSTNIP00000009938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]