SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010069 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000010069
Domain Number - Region: 23-70
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00314
Family Glycerol-3-phosphate transporter 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010069   Gene: ENSTNIG00000007265   Transcript: ENSTNIT00000010249
Sequence length 102
Comment pep:novel chromosome:TETRAODON8:11:9303222:9304314:1 gene:ENSTNIG00000007265 transcript:ENSTNIT00000010249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSVFKTIPTHMDYKGQKLAEQIFQGIILVSAVIGFVYGLIIEQFGWTVYIVLAGFAVSC
VLTLPPWPMYRKNPLSWQPLIPDVSGETSQKPSEGIKKKKHK
Download sequence
Identical sequences Q4SRD1
ENSTNIP00000010069 99883.ENSTNIP00000010069 ENSTNIP00000010069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]