SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010201 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010201
Domain Number 1 Region: 281-330
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000017
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010201   Gene: ENSTNIG00000007395   Transcript: ENSTNIT00000010382
Sequence length 335
Comment pep:novel chromosome:TETRAODON8:1:5847012:5850279:-1 gene:ENSTNIG00000007395 transcript:ENSTNIT00000010382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INNVTFEALYHLLVVMLTLGGGVQSMPVPTDVPMCTASEPAHYKLTFTGKWSRSAFPKQY
PVYRPPAQWSNVVGVTHSSDYHMWQQNGFASNGVKEFSEKGEAWTLIKEVEAAGERIQSV
YGIFSAPAVLGGTGQMNTEFEVFARHSYLSFIVRIVPSPDWFVGADSVDLCEGDHWKENV
SLELFPYDAGTDSGFTFSSPNFETIPQDKITQITSSFPSHPANSFFYPRLKHLPPMAKVT
LTKVKKTNQIISLPVEPTQSNQLPTGNEIEDNLITPDTPLDCEVSVWSPWGLCRGKCGDS
GVQHRTRYILMHAANSGKACPQLEEERKCFPDNCL
Download sequence
Identical sequences H3CPL8
ENSTNIP00000010201 99883.ENSTNIP00000010201 ENSTNIP00000010201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]