SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010226 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010226
Domain Number 1 Region: 376-558
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.1e-58
Family SPRY domain 0.0000172
Further Details:      
 
Domain Number 2 Region: 10-74
Classification Level Classification E-value
Superfamily RING/U-box 6.63e-20
Family RING finger domain, C3HC4 0.0063
Further Details:      
 
Domain Number 3 Region: 160-224
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000351
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010226   Gene: ENSTNIG00000007420   Transcript: ENSTNIT00000010407
Sequence length 562
Comment pep:novel chromosome:TETRAODON8:Un_random:1800650:1804528:1 gene:ENSTNIG00000007420 transcript:ENSTNIT00000010407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSPGGRLLSEEQFSCSICLEVFVEPVSTPCGHSFCKACLQGYWNHSKKFVCPMCKKSYPK
KPEMSVNRVLAEISTQFQGLTLSGGAASGAAVMNASTDGGRVASPGPDTGEFARAGEVPC
DACIGRKLKAHKSCLNCPGSFCQTHLRHHKKVKSLISHRLVEPTFHLEEKLCKKHERLLN
RYCRTDHACVCTSCADSTHKSHDIVSTDHEWKKKMSHVGKKRSELKHLIKERTKKLEEIK
ESIKVIKSSAQKELEESWQVYAELQRMVEQSQAELVEAIATKQREAERHAQELARGLENE
LSQLRRRSSELEAHAQIQDRVLFLQKLATLPPAPEPSDWSGVSISTDLYLGTIRSSVSHL
MDKFQEELKRLYAKELRKVQNYSSEVILDPGTAQKNLVVSEDGRQVKYEDRKSNHSEGPK
RFSPALFVLGREGLVSGRHYWEVDTGRKTAWTLGVASASARRKGEIKLSPEGGFWCLWLK
NGEVKALASCRLPLMLPSPPAKLGIFLDYEEGQISFYDVKARLHLYTFSDTFTESLYPIF
SPCLNPEGKNAAPIVITQVKHA
Download sequence
Identical sequences H3CPP3
99883.ENSTNIP00000010226 ENSTNIP00000010226 ENSTNIP00000010226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]