SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010271 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010271
Domain Number 1 Region: 117-181
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.00000000000000144
Family Thyroglobulin type-1 domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010271   Gene: ENSTNIG00000007463   Transcript: ENSTNIT00000010452
Sequence length 196
Comment pep:novel chromosome:TETRAODON8:17:10888269:10890334:-1 gene:ENSTNIG00000007463 transcript:ENSTNIT00000010452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPETPNQPLIRGNTAATEPANGGRSTRAYKVAGITLLACVLVVGQAMTAYFLLTQKGEI
KSLEEQSNKLKSEMTKGRSEAASSSQMRIPAIPIPGLFDISLDKDTEPEKKEGPANPQVT
DCQLKASGMKSSGVPGFSPVCDERGFYQAEQCFMGQCWCVNPLSGDVIPGSMRNGQASCS
TAAVAGSLSRAMAVPE
Download sequence
Identical sequences H3CPT8
ENSTNIP00000010271 ENSTNIP00000010271 99883.ENSTNIP00000010271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]