SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010335 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010335
Domain Number 1 Region: 45-269
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.04e-72
Family Lectin leg-like 0.00000000671
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010335   Gene: ENSTNIG00000007526   Transcript: ENSTNIT00000010516
Sequence length 522
Comment pep:novel chromosome:TETRAODON8:4:6576786:6583906:-1 gene:ENSTNIG00000007526 transcript:ENSTNIT00000010516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSIARRPAANAPLLVLTFLTVLINHHSVADVPADASTPEEPPHRRFEYKYSFKGPHLS
QSDGSVPFWTHTGSAIPSADQVRITPSLRSQRGSIWTKNKVIFEHWEAEVTFRVSGRGRM
GADGLAVWFTTSQGLEGPVYGAADQWNGVGVFFDSFDNDGKKNNPAIIVVGNNGKLVYDH
QNDGTTQALGTCLRDFRNKPYPIRAKITYYKKTLTVMINNGFTPNKDDFEFCTKVDNMII
PTEGFFGISAATGGLADDHDVLSFLLFRLTEPGQQLSFQLKPPAESEIPKEEKDKYQEEF
QNFQQELDKKKEEFQKEHPDVQGEPIEDVYETASDREIRQVFEGQNQIHLEIKQLHRQLA
MILDEQRRYVSVITDEVVKKAASAAPGQVDSASQQQLGSVLATQQEVLQKLNELRNNFHE
SVKQIGSAQHQGSAGGLGTYETVQHFNDIKEHLHMVKRDVEHLVQRSAQNPAEKAVKCPE
LPPVPSCLSTIHFIIFIVIQSVLFFCYIMYKSQQEAAAKKFF
Download sequence
Identical sequences H3CQ01
ENSTNIP00000010335 ENSTNIP00000010335 99883.ENSTNIP00000010335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]