SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010336 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010336
Domain Number 1 Region: 100-146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000061
Family EGF-type module 0.0035
Further Details:      
 
Domain Number 2 Region: 58-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000013
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010336   Gene: ENSTNIG00000007527   Transcript: ENSTNIT00000010517
Sequence length 377
Comment pep:novel chromosome:TETRAODON8:4:6588949:6602938:-1 gene:ENSTNIG00000007527 transcript:ENSTNIT00000010517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWSFQDEDASHGREECSENNVSTTKYPCVKSTGEAATCYRKKCCKGFKFVLGQCIPEDYD
VCTGAPCEQQCTDHFGRVVCTCYPGYRYDRERHRNRQSPYCLDIDECADRNMSACSQLCV
NSVGSYRCECEKGYFLEEDRKTCTKGERAFFPNRCGHDSKSDNVMNAGTCSATCDDFLQI
KMSVLQLKQNMTVLSNSADVRRQMTRQKLLTSPVFLPGPPGLPGPPGLPGPPGGPGPEGP
PGLKGPPGLPGPRGLMGPMGPTPDLFHIKRGPRGPVGPPGAPGKNGLKGDRGAPGPTGPP
GPPGSFDFLLLLMAEIRNDISELQNKVYGRPVHSQGEDFPAAPDSWVDNQEYLDAGSGEN
YKEPPQKDGEGFKRSRK
Download sequence
Identical sequences H3CQ02
ENSTNIP00000010336 99883.ENSTNIP00000010336 ENSTNIP00000010336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]