SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010427 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010427
Domain Number 1 Region: 782-1022
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.12e-83
Family Eukaryotic proteases 0.00000703
Further Details:      
 
Domain Number 2 Region: 341-499
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-36
Family MAM domain 0.0046
Further Details:      
 
Domain Number 3 Region: 521-632
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.93e-30
Family Spermadhesin, CUB domain 0.00085
Further Details:      
 
Domain Number 4 Region: 67-165
Classification Level Classification E-value
Superfamily SEA domain 0.000000000000116
Family SEA domain 0.0065
Further Details:      
 
Domain Number 5 Region: 220-330
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000366
Family Spermadhesin, CUB domain 0.0045
Further Details:      
 
Domain Number 6 Region: 639-677
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000236
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 180-219
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000288
Family LDL receptor-like module 0.003
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000010427
Domain Number - Region: 687-765
Classification Level Classification E-value
Superfamily SRCR-like 0.000876
Family Scavenger receptor cysteine-rich (SRCR) domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010427   Gene: ENSTNIG00000007612   Transcript: ENSTNIT00000010608
Sequence length 1024
Comment pep:novel chromosome:TETRAODON8:7:11470766:11476374:-1 gene:ENSTNIG00000007612 transcript:ENSTNIT00000010608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LITDWFIGSMARRLSSLEILLSVLTSLVLLCCVALIVLTSLTLKSRVNGADAAEPAVLSA
QMVVTEGAVFSDELYNSSSLLFKSLAFDVENLVSKAYGHSGVRRLFRSCQVSSFSQGSVV
VTSDLWFNQPISPKEAEAQLKAGLQAAAPTELVIDLDRILITDNDETTVMSTVSATPAFS
TVICPHPQRSCDDGSTCVPIGRFCDGVIDCPDVSDEDPARCATSCDGQFLLSGPAGSFSS
STHQYNISSFCRWIIKVDEGLSIQISSQRFDTGNNWDGLRLYEGIGEGKNLTGETPEGGA
GVCGKHYEATVELTSNDVNGLLGFNATYRAANTSGLSDEQKLTCTFEQGLCFWRQQQDDD
DGDWIRARGATFPPLSGPSADHTLGNSSGFYLVTPPSPGQWQKSFRMRSLRLTAAAAPAC
LSFWYHMFGEDVHRLHVLLLQPAVTLVFQKEGNYGDSWNYGQVTLNLTADTMVVFEALKK
GGTRNDIALDDITLTSGPCGPDPPQPTNVPPPTTAPPIPADCGGPFDLWEPNSTFSSPNY
PQSYGNKAKCLWTLRTTEERNIQLHFLDFDVEATYDMVEVRDGAGPASSLLAVLTGSQGP
IGDFYSTTNEMAVWFFTDASGSGRGFRANFTSGVRLGSPAPCAHGQFQCSSGSCIHGDGR
CNGVADCPDSSDEADCVFLKVNGSSRLQFQVGSALLTACTDTWSSGFSVSTCQYLGYRFG
NATQLPALPQDSPFTNITVASNGRVTISASETCSSEEVVSLTCDNQPCGVRQASNNATTV
DRAAEGDSKVVGGANAAKGAWPWIVSLHWRNKHACGASVVGRDWLLTAAHCVYGKNMHLG
LWLAVFGLHAQSGINSAEVQTRRVDRIVINSQYNRQTKQADIAMMHLEQPVNFTQSIQPV
CLPPDSQNVTAGRRCFIAGWGRDTDGSGSLPDVLQQAEVPLVLQEQCQDWLPEYTITSSM
VCAGFAGGVDTCQGDSGGPLMCLDEGRWTAVGVVSFGTGCGLPQKPGVYARVSAFTSWIA
QTRR
Download sequence
Identical sequences H3CQ93
99883.ENSTNIP00000010427 ENSTNIP00000010427 ENSTNIP00000010427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]