SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010550 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010550
Domain Number 1 Region: 176-311
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000298
Family Growth factor receptor domain 0.0091
Further Details:      
 
Domain Number 2 Region: 147-188
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000652
Family EGF-type module 0.016
Further Details:      
 
Domain Number 3 Region: 113-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000021
Family EGF-type module 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010550   Gene: ENSTNIG00000007733   Transcript: ENSTNIT00000010731
Sequence length 314
Comment pep:novel chromosome:TETRAODON8:16:1792293:1797842:-1 gene:ENSTNIG00000007733 transcript:ENSTNIT00000010731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDLNYYGPLCNKFCRARDDFFGHFSCNLSGSKVCMEGWTGPECKEAVCKQGCHQSHGFCS
EPGECKCHYGWKGPLCDQCVTFPGCVYGSCTEPWQCVCDVNWGGLLCNKDLNYCGNHQPC
KNGGTCTNTEPNEYQCECQEGFRGRNCDIAVRQCDRSPCGHGASCQEIPGGFRCLCPPGW
TGRTCQLDANECEVSVCIHAHSCHNLIGGYLCDCLPGWVGPNCDIRNSSCQDLCQNNGHC
EDLVSGSRCVCPPGFSGTYCQNAPRPCEGAPCLHGGQCVETAGTSATCICPAGYSGNLCE
RALDLCDPNPCQQG
Download sequence
Identical sequences H3CQL6
99883.ENSTNIP00000010550 ENSTNIP00000010550 ENSTNIP00000010550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]