SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010587 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010587
Domain Number 1 Region: 90-357
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.33e-91
Family Eukaryotic proteases 0.0002
Further Details:      
 
Domain Number 2 Region: 18-118
Classification Level Classification E-value
Superfamily SRCR-like 3.4e-16
Family Hepsin, N-terminal domain 0.091
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000010587
Domain Number - Region: 1-19
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00477
Family LDL receptor-like module 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010587   Gene: ENSTNIG00000007769   Transcript: ENSTNIT00000010768
Sequence length 360
Comment pep:novel chromosome:TETRAODON8:16:1221096:1223490:1 gene:ENSTNIG00000007769 transcript:ENSTNIT00000010768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDGVRDCTLGSDETACVMLGNDNILQVKTSQDGRFLPVCYNGWDESLAKETCTKLGFRNF
YATNPSTSQPKSSPTLTINSRSSPYLQYLHLCLVVAFHSSSCPGQQTVALQCLDCGQRRS
TSRIIGGNVAKLGQWPWQMTLHFRGSHVCGGILISPDFVLTAAHCLSNKLAILAENWEVY
SGVESLDKLPKPYKVKRILLSELYNSDTNDYDVALLKLAAPVVFDDNVQPACLPSRDQIL
APGTQCWTTGFGTTEDGSSSVSKSLMEVSVNIISDTVCNSVTVYNKAVTKNMLCAGDLKG
GKDSCQGDSGGPLVCQEDDRWYVVGITSWGSGCGQANKPGVYTRVSSVLPWIYSRMQVRP
Download sequence
Identical sequences H3CQQ3
ENSTNIP00000010587 ENSTNIP00000010587 99883.ENSTNIP00000010587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]