SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010619 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010619
Domain Number 1 Region: 325-380
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000017
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 2 Region: 435-490
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000405
Family TSP-1 type 1 repeat 0.00029
Further Details:      
 
Domain Number 3 Region: 379-435
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000772
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 4 Region: 268-320
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000131
Family TSP-1 type 1 repeat 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010619   Gene: ENSTNIG00000007799   Transcript: ENSTNIT00000010800
Sequence length 1500
Comment pep:novel chromosome:TETRAODON8:Un_random:35877725:35912861:-1 gene:ENSTNIG00000007799 transcript:ENSTNIT00000010800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSTLIQNRFFGFFLSSSVFPSMPCSWTLQNPDPRRYTVFIKVTKPASDCVPSQLRTFQYD
SFLETTRTYLGMESFNEVVNLCNTSTPVAFLEAGKQFLQMRKAPPGAGAGFPPTAGDGEF
KTEYLVVGKRNPSEAACQMLCQWLEDCLASSTSSRPCGIMQTPCLCWEPPPQQGGGGEGG
GCYRNGLYLENCVPSLEDSANGAHVKAILPTTTFRLMIKAAPRDPFPRQQSEDYGEDEVK
SLPPSSLMSQSRPPPHQGQGLLTAEEAEGGWSVWAQWADCSSQCGGGIQTRTRSCRSPPE
ESSLCEGVVEEGRPCNPQPCTAALIPVNGAWDEWSPWSLCSSTCGRGFRSRTRTCTPPQF
GGEPCVGPEKQTKFCNIAVCPVDGVWNEWSSWSSCSASCANGTMQRTRECNGPSYGGSEC
RGKWLESVHCFLGECPVDGRWQPWSLWSSCSRSCGGGTQQRSRLCYGPFFGGQPCPGERE
EVRSCSEKRCPEPHEICSEDNLSSVAWKMTPAGETAAVRCPPNAMGLILRRCALNEEGVA
YWEEPTYMKCVSNDYRSIQTLTREHLSKAQRGLVGDGVSEVMTKLKVTSSDGTSYSGDLL
AILDVLKNMTEIFRRAYYSPSSADMRNFVQSLSNMLMEENRDRWEEAQLLGPNIRQLFRL
VEDFVDVIGLRMKAFQDMYEVTDNLVLSVHKRPVVLTGDINFPMKGWRGMVDWARSSEDR
VTLPKNIVSTEQTVITEVDESSTFVSGIVLYRNLGSILALQRNSTVLNSKILSVTIKPSP
VLLSAPVVIDFSHLYNGTTNHTCISWDESDRLLLWSSAPLGQLTSSGEQPLPRNSSRRVC
WCYLRLLSFSWLVQCDPPVNMEKLQLPSVTLIVGCGVSRSVSSPLIGPFLHRYIRSERSV
ILINFCLSIISSNALILIGQTQTWNKVLCTLIAAFLHFFFLSSFCWVLTEAWQSYMAVTG
RLRNRIIRKRFLCLGWGLPALVVATSVGFTKAKGYGTPSYCWLSLEGGLLYAFVGPAAAV
VLVNMVIGILVFNKLVSKDGITDLKLKERAGQMTVPLYNMTLKCAKCGVISSADVSTTAT
SNAMASLWSSCVVLPLLALTWMSAVLAITDRRSALFQILFAVFDSLEGFVIVMVHCILRR
EVQEAVKCRVVDRQEDANGDSGGSFQNGHAQLVTDFEKDVDMACRSGLHPLSRRFQPELL
LFPPGTTKRLSVQGEEKASSGSLSLQKGSNFNTMPANLAKVHLQNVVDYPSHTLSLRREK
ATAKGISTELPGAKSIYICDSELFKQLDGGEGGGEGAAKTQGYVLLPGATSSTLKPTKGK
EELPQTRLLHLSSSGSAEPGPDKDSPPHLQNLPREPKGAGGASRAEAGNPAVMSKSETVS
TLSMSSLERPKSRYAELDFEKIMHTRKRHQEMFQERNKKIQGADKESESPPGSQDEDKQQ
TPSRKAWEGIRKSHSPPSWVRKDLEPVAASPLELQTVEWEKTSATIPLVGQEIMDLQTEV
Download sequence
Identical sequences H3CQT5
ENSTNIP00000010619 99883.ENSTNIP00000010619 ENSTNIP00000010619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]