SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010708 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000010708
Domain Number - Region: 327-383
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00144
Family EGF-type module 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010708   Gene: ENSTNIG00000007888   Transcript: ENSTNIT00000010889
Sequence length 870
Comment pep:novel chromosome:TETRAODON8:15:2683155:2686289:-1 gene:ENSTNIG00000007888 transcript:ENSTNIT00000010889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVCILFLLWATCMLSEEAVSETCRGTRCFPDPDWIGPCVGAHCQGLRDAASSRTFPNS
AQPRPVRVYPSFQQDARFSPYQGQSAPLAPYAVVQAQQAVPDARRTNPKTLTADVAHPCA
GGTCPPADGDDTAARGCKGVGCKLPGRMRHKPKPCVGNGCGAHAEELGRGGAAPVHVRDT
AAQFLSEFGSETGAWIQLTCDMKAGANDVPSEDALVLQLQLSEDQKDLVEALKSQQEEVR
ELQRLLGEQQGTLLLQQREILEQQRSMFEQLEDVKSHYNLMMETIKQTSFQNIQGDLGGH
VETPSVRDGAGNAQQALALHKVDMEASVMEDRDECLEIPGLCRDQQKCLNTPGGFRCPGM
TEHDAFSGLCGHGYFFNAAVDECQACNDCDGEPAASPCTANADTVCSGAAASAAPEAALS
LSWAGDVSLPGAEGHTLAHFSHGAQLHVSGRSDSALVAVEKGRLVLRQHGLVWLDENLSV
HHGCRSFIQACLRLNSTHGSEGRHLSGVRVEQQDARSFQSASISGVAEVAPGDLISLSVR
SASQHCNDSSEGVQLFHHSAASLSLLWLSHDTGAVAMTAQAAVSAHYHTNHRLAFRTTYT
SDPYVVGLTHDGRGIRFAESGAVRFVFQQALYSMGHACVSEGFQVLAYLNHNGTGSELCR
SFRPGVHYRDTSLSLSGAATVAPGDTLLLEILSPPQCNVRFFGDETGISALSLVWVPAAL
SSSLSASVSNASLPSGAVRNKPLFFRQTTAGVAQMDLQGRGSAGHRRDVVFRESGTASVA
LDLKLIHSCNLVKVTLLRRGAAEGARPVPLAQQVEGQMPEGSRYARVSLRASFQVHNGTA
VFFTLDCVRGRVNQISHQSGSGVSILWVAA
Download sequence
Identical sequences H3CR24
ENSTNIP00000010708 99883.ENSTNIP00000010708 ENSTNIP00000010708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]