SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010753 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010753
Domain Number 1 Region: 330-487
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.81e-46
Family SPRY domain 0.00022
Further Details:      
 
Domain Number 2 Region: 109-176
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000244
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Domain Number 3 Region: 7-58
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000272
Family RING finger domain, C3HC4 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010753   Gene: ENSTNIG00000007933   Transcript: ENSTNIT00000010934
Sequence length 487
Comment pep:novel chromosome:TETRAODON8:15:2276901:2279327:1 gene:ENSTNIG00000007933 transcript:ENSTNIT00000010934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAMASLELELTCSVCRDVFSQAHPLPCGHSLCPACVREAWSRPAEGRSGFVCPQCQEERG
EVPCDCCPADAGQGEPALALKTCLRCEVSLCADHLQPHLDRPAFSSHLLVDPLGDLSHRR
CPEHGEILRYYCAEDRLYVCGDCLLEGGHAQHNVKALRQVEEELKALLGKADEKLKDGEK
VLAEFENIDSTAADSLKRDDSQVARLGSDLQLQVQNLVLALRDITRKEREQLLERVKEDC
SRVREDMSQTLSIQHYLASLLAETDPFLLMLLADLNSPLFVPDPISLDRKHILEDVEHKY
RDFITAALRCLTELKRELCECRLWGRALTSPLTLDPNTAHPLLSISHDLRSAVRVHQRLP
LTAHPERFDHWPQVLTVQTFSSGTHYWELEAEGFWDIGVCYRSIGRKGKEGNAFGINKVS
WSLTQQHDRKLAAWHNRRKTRLSHQMAGNRVGVAVDYGAGTITFSEVGASGSLTHLHTFT
VTFSQPL
Download sequence
Identical sequences H3CR69
ENSTNIP00000010753 ENSTNIP00000010753 99883.ENSTNIP00000010753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]