SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010775 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010775
Domain Number 1 Region: 153-463
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.09e-119
Family Transglutaminase core 0.000000014
Further Details:      
 
Domain Number 2 Region: 7-152
Classification Level Classification E-value
Superfamily E set domains 2.03e-45
Family Transglutaminase N-terminal domain 0.00015
Further Details:      
 
Domain Number 3 Region: 479-589
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.07e-30
Family Transglutaminase, two C-terminal domains 0.00059
Further Details:      
 
Domain Number 4 Region: 590-687
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.62e-28
Family Transglutaminase, two C-terminal domains 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010775   Gene: ENSTNIG00000007953   Transcript: ENSTNIT00000010956
Sequence length 690
Comment pep:novel chromosome:TETRAODON8:15:1932756:1938644:-1 gene:ENSTNIG00000007953 transcript:ENSTNIT00000010956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVTEAKLSVCSVDLLSSKTGRNRAEHHTDLYHGDELIIRRGQTFQIEMELSRPFSTDADR
LHLDMKTGPLPTVSKGTHATIPLVDSLKGKRWEAKIVEQSGNKVKLSVNSPASAVCGQYR
LTVTCGSAEGEATTTHDCSKNIVMLFNPWCEEDTVFLQDEEEKKEYVLNDTGRIYYGTEK
QIGARTWNFGQFHEGVLEACLFVLERSDIPASGRGDPVNVVRVISAMINAQDDCGVLVGN
WSGDYSNGVSPTAWSSSVEILRKYHSSGGNPVSYGQCWVFSAVTTTVLRCLGIPSRSVTN
FQSAHDTDVSLTTDIYLDENMDPIDYLNSDSVWNFHVWNDCWMARPDLPPGHGGWQAVDS
TPQETSQGTFRCGPASISAIRSGQVFLKHDTPFVFAEVNSDKIYWQRNVDGTFSQIYSEK
KAVGHFISTKAVGSDERADITHLYKHQEDSEEERIAVETASRYGSKPNTYSSPIAEDVSV
EVKIDDNGARMGADAELSILVKNLSSHPRQTTLHSQVAVMYYTGVVKGTIKKEQISVELQ
PNEEKTIQWVLTYQQYQNQLVDQGALMLTLSGRVNETQQVLANQTTFRLRTPDLIIKPLG
KAVVGKEMAAKITFTNPLPRMLEGVVFRVEGLGLQRDHEVVVGDVGAHSTLTLTEHFIPT
QPGPRKLVASLDCKQLTQVHGVADIVVLEK
Download sequence
Identical sequences H3CR91
ENSTNIP00000010775 99883.ENSTNIP00000010775 ENSTNIP00000010775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]