SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010820 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010820
Domain Number 1 Region: 17-203
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-44
Family SPRY domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010820   Gene: ENSTNIG00000007998   Transcript: ENSTNIT00000011002
Sequence length 599
Comment pep:novel chromosome:TETRAODON8:15:674733:679922:1 gene:ENSTNIG00000007998 transcript:ENSTNIT00000011002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKELNQRLRRLYPAVNENETPLPRSWSPKDKFSYIGLSQNNLRVHYKGHGKTPKDAASVR
ATHPIPAACGVYYFEVKIISKGRDGYMGIGLSAQGVNMNRLPGWDKHSYGYHGDDGHSFC
SSGTGQPYGPTFTTGDVIGCCVNLINNTCFYTKNGHSLGIAFTDLPPNLYPTVGLQTPGE
VVDANFGQHPFVFDIEDYMREWRTKIQAQIDHFPIGEREGEWQSMIQKMVASYLVHHSYC
ATAEAFAKSTDQAVQEELASIKNRQKIQKLVLSGRMGEAIDTTQQLYPSLLERNPDLLFM
LKVRQFIEMVNGTDSEVRCLGGRSPKSQDSYPGSPRPFGSPSHKPASSQLYLSGFDSNCC
NGVTSKSHSSSPHSHKPCPPGPASNPPASDISLNGSRSQQNISRYPDGPAPPPGASGPGS
EVALTDVDMEVDHFSNGVAESSSNGFLNGSSKHAGEADDCEADMGGGAEVESAQNKRQLC
GGSQAAIERMIHFGRELQSMSEHLRRECGKNSANKKMLKDAFSLLAYSDPWSSPVGYQLD
AIQREPVCSTLNSAILETHNLPKQPPLAQAVGQAAQCLALMARTGSGSCAFASVDDYLH
Download sequence
Identical sequences H3CRD6
ENSTNIP00000010820 ENSTNIP00000010820 99883.ENSTNIP00000010820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]