SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010885 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010885
Domain Number 1 Region: 2-34
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000445
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 858-910
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000628
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 3 Region: 678-734
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000017
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Domain Number 4 Region: 619-677
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000183
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 5 Region: 796-855
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000118
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 6 Region: 738-793
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 7 Region: 561-617
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000275
Family TSP-1 type 1 repeat 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010885   Gene: ENSTNIG00000008061   Transcript: ENSTNIT00000011067
Sequence length 940
Comment pep:novel chromosome:TETRAODON8:8:8896695:8916462:-1 gene:ENSTNIG00000008061 transcript:ENSTNIT00000011067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGVWSVWGEWSECSQSCGGGVSTRTRTCLPPPPRQTPPISHSIPNWAGYLPGGLGGPVVP
PARPYYPSYPGQQPPYHQPSIPTNQNTGLPLFRKSSSIRPGQFGYGRVPFSLPLHRTNRQ
ARHTVNGSDAATPAPPPAHAAADRTEEEEEWVNEALRTEEEPTGAPPAETTPAPAVAGGP
TRPLADWPPPRTDPGRAQLPSSHSSSRSSSPSLQPSRQRKEERAHGKPSIPGSSRTPDRF
LPQLVDETESHGKCSLFATAVSSEQRKRKEERIKAAYQKGMPRKRGRVPSGQCAAFDSQE
FMGRLYNWEPFTEVGADKQCELTCRPAGYRFYVRLAERVRDGTPCFNVTSGDVCVEGRCT
TEGCDGILGSGAVVDKCGLCGGREASCRKVTGSFQNLTVPHGYHKILDIPAGATFITVTE
RRASPNYLAMRSGTGASVVNGRWAVDPPGEYRAGGTTFTYTRPRGQAEGEEQRGESLSAP
GPTSTQLQLYIIFHKENPGIDYEFYVPGPLTVSVEDPLPAPPPPPVAGPSFPSSSSSVFV
PPSQDRWPPDRSRSRGSAPNRWRRGGFTECTASCGKGSHFRVIICVDRHTDEEVPERRCD
SAAKPVPEEEPCNAHPCPPFWEASSWSECSVSCGPGVQQRQLQCRQSFGNRSTMVHPQRC
ANLTPPESTQTCQLQLCSHWEVSSDWSQCSVDCGIGRRTRSVRCVTDQGSVVNDAECSTR
AKPQGSEECNMGPCVTNWYFTSWSKTCSAQCGPGVQKREVVCLTRSGVKGGGGGGDCVGD
KPAEMKACNGGPCVPTTMWYSSPWSQCNVPCGNGTQRRDIICVQRAGSEFTVAQASECAH
ADKPAVVRQCEMGECTPQWFTTEWSACSQSCGKGVQMREVRCLTEDKRHSSDCQPDTKPE
QEQSCNVAPCGPQPSDENCRDKHHNCVMVVQARLCVYTYY
Download sequence
Identical sequences H3CRK1
ENSTNIP00000010885 ENSTNIP00000010885 99883.ENSTNIP00000010885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]