SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010970 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010970
Domain Number 1 Region: 2-97
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.2e-30
Family Dachshund-homology domain 0.00084
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000010970
Domain Number - Region: 375-422
Classification Level Classification E-value
Superfamily BPTI-like 0.0474
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010970   Gene: ENSTNIG00000008144   Transcript: ENSTNIT00000011152
Sequence length 771
Comment pep:novel chromosome:TETRAODON8:6:2129556:2132033:1 gene:ENSTNIG00000008144 transcript:ENSTNIT00000011152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDLECGFEEMQGVRLGYLLIKGKQMFALSQVFTDLLKNIPRTTVHKRMDHLKVKKHHCD
LEELRKLKAINSIAFHAAKCTLISREDVEALYFSCKTERVLKSNKRKAKAACSPGDDGDE
TTAGLLRADAKLWKEKVWFSLHGVPRTFTLHKKTSKTRALAPRLTDSKLPQFYHKTNERE
CRSLTKSSYKHFKNYETAKITGNRVTLSQRQSFFRSRQPVVLQSAMAAQSRLLRSAGDKR
KRRREGGGGRDGARHSWNRSRHAHQHLPPVLFLQPKSPDGHATSFDHVPSFPEGYSSDTE
SSTYSDREYPDSDFGSGFSTSSNSGSYDHTQSESSEASSDEEESSSQSDSSSVSSRVSIQ
SIRFRRARVGSLTKPPNTKPPLLLQPTFHYNNQPQHDTQHHTPSAGGDDSRHEKRQKCEF
ICTESGKDFGASQISKLSSAATGKSFFTEQKLQKADLNRTDSSGELTSYLPGCNWKAFQS
PRRTTGHPTKGSSGPGAPSHLDTLPKCAEKREARTANQKPSSPVKKIKSEAEETCVTAGP
HAVNGRTARTPPFNLHNVKIKVEESLDEYEYQSQDSSVKCKTDTSNGQHQSGAIKQADFF
SGEIKTTERGPGVSPESPCGPQECVQEKPCTDEEKAVSKSCKPAGPRSKRSGVFGARTKR
KVPRINQAASSCSSPSSSRPGCEDASAEDLPSRRKRNAGNPTSPGKPSFSLMANFPTPPS
LVVGSDGDLCPAYSLNSLRGPGPPPPSHPVWRWQPGGHVLPPPQAPKTRKY
Download sequence
Identical sequences H3CRT6
99883.ENSTNIP00000010970 ENSTNIP00000010970 ENSTNIP00000010970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]