SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010993 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010993
Domain Number 1 Region: 6-454
Classification Level Classification E-value
Superfamily Sema domain 5.89e-138
Family Sema domain 0.000000105
Further Details:      
 
Domain Number 2 Region: 802-860
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.09e-16
Family TSP-1 type 1 repeat 0.00021
Further Details:      
 
Domain Number 3 Region: 748-803
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000405
Family TSP-1 type 1 repeat 0.00038
Further Details:      
 
Domain Number 4 Region: 559-609
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000484
Family TSP-1 type 1 repeat 0.0004
Further Details:      
 
Domain Number 5 Region: 450-501
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000549
Family Plexin repeat 0.0032
Further Details:      
 
Domain Number 6 Region: 613-665
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000196
Family TSP-1 type 1 repeat 0.00064
Further Details:      
 
Domain Number 7 Region: 503-556
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000183
Family TSP-1 type 1 repeat 0.00094
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000010993
Domain Number - Region: 863-906
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00301
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010993   Gene: ENSTNIG00000008167   Transcript: ENSTNIT00000011175
Sequence length 1050
Comment pep:novel chromosome:TETRAODON8:6:2409112:2456082:-1 gene:ENSTNIG00000008167 transcript:ENSTNIT00000011175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVLSVAEMEPWIFRFKAEGTVDYSQLTFDPGQNELIVGARNHLFRLNLEDLTLIQEAEWH
CDEFTRGACFSRGKSEEECQNYIRVLLVNGNRLFTCGTNAFTPICTNRTLTNLTEIHDQI
SGMARCPYNPLHNSTALITSSGELYAATAMDFSGRDPAIYRSLGGLPPLRTAQYNSKWLN
EPNFVSSYDIGNFTYFFFRENAVEHDCGRMVFSRAGRVCKNDIGGRFLLEDTWTTFMKAR
LNCSRPGEVPFNYNELQGTFYLPELELLYGIFTTNVNSIAASAVCTFNLSAIAQVFRGPF
KYQENSRSAWLPYPNPNPDFQCGTIDSGSYVNLTERNLQDAQKFLLMHEVQPVDPVPYFM
EDSVRFTHVAVDVVQGKDVLFHIIFLATDYGTIRKVLSPLNHSTGSCLLEEIELFPPRKR
QPIRSLLILHSRSELYVGVRDQVIKIPLKRCSYHKSREACVGARDPYCGWDLLLKKCTTL
EESVRMSQWEQSITKCPVRNVTVDGGFGAWSGWSACSHNDGGNGGSCLCRTRACDSPSPQ
CGGQQCQGISVEVANCSRNGAWTPWTSWSPCSTSCGIGFQVRQRSCSNPSPRHGGRVCVG
QNREERYCNEHLPCPPHVYWSAWSVWERCTVACGGGIQSRRRTCENGNDCPGCGQEYQSC
NTLPCPDLKKTTPWTPWTPVNISDNGGHYEQRFRYTCKARIPDPSLLEVGRQRIEMRYCS
SDGSTGCSTDDCLIGDVLRLGRISGNTLNGGWSSWTSWSQCSRDCSRGIRSRKRTCNNPE
PKYGGQACQGPAQEYQECNITPCPVDGSWSCWSSWSKCSVTCGGGHYMRTRTCSNPPPAY
GGDICLGLHTEEALCNTQPCPESWSSWSAWHCDSNGAQMRMRHCDVLFPTGNQCSGNNSE
ARPCTPDSNLIPEVSIARSSQDERRCGDFNLFHMIAVGLSSSILGCLVTLLVYSYCQRYQ
QQAHDATVIHPITAAPLNTSITNHINKLDKYDSVEAIKAFNKNNLILEERNKYFNPQLAG
KTYTNAYFTDLNTSERTPPTAPLSLCFPIL
Download sequence
Identical sequences H3CRV9
ENSTNIP00000010993 ENSTNIP00000010993 99883.ENSTNIP00000010993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]