SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011011 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011011
Domain Number 1 Region: 71-118
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000131
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000011011
Domain Number - Region: 32-75
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000379
Family Somatomedin B domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011011   Gene: ENSTNIG00000008185   Transcript: ENSTNIT00000011193
Sequence length 257
Comment pep:novel chromosome:TETRAODON8:6:2891298:2893275:1 gene:ENSTNIG00000008185 transcript:ENSTNIT00000011193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTCLLLTVCTLSKSLLVSGGCLGRCCQGRDLDCFTTDWRMDRVYGTCYCDQACLQTKDCC
FDYFTECPARNCIVSEWSFWSGCAGTCTTSFRARVREVAQRPSHSGAPCPSLEQRSGCRV
YTDFWGRNCEHSSGPAVITSMAFGKARPKHDHYGNPLNPGFCMEFTVESRTSHCSLVNQP
HTRWMRYITEGFVVCVACEPPAMPNEGGSCRGDGRESDQDTLLHWQAAVNHQCSGTWRKI
RKTRQCNCPPQHSFVFI
Download sequence
Identical sequences H3CRX7
99883.ENSTNIP00000011011 ENSTNIP00000011011 ENSTNIP00000011011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]