SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011029 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011029
Domain Number 1 Region: 30-139
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-27
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 2 Region: 211-282
Classification Level Classification E-value
Superfamily Kelch motif 0.0000000116
Family Kelch motif 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000011029
Domain Number - Region: 172-204
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00447
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 142-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0121
Family EGF-type module 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011029   Gene: ENSTNIG00000008202   Transcript: ENSTNIT00000011211
Sequence length 332
Comment pep:novel chromosome:TETRAODON8:8:957270:960005:-1 gene:ENSTNIG00000008202 transcript:ENSTNIT00000011211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLLPVSLTLLLLLSAKLHGCQAGDCKGHRQVLRGPPGYVTDGPGNYSVNGNCEWLIKA
PSNSHRIVLNFTFMDTECTYDYLFVYDGDSYQSPLLASLSGNTLPQPIEAKSGKMLLHLF
SDANYNLLGFNATYTFSLCPGACGGHGRCDSSTLKCHCQHGWGGAACTTPLCSKSCSVNG
QCDKKGERCLCKPGFVGQNCQLGLNDDGGAGQWWRVSEGNPYIPPRTGSAGVYLAPAGSL
YMFGGFDLNRALGDLIKFNLTSNQWESRSYGHSPVSHVWVCSNSHSLHSRFPHFWGCSSV
NSKANEKAHLYASLFKIAEQDKNKADENIFPL
Download sequence
Identical sequences H3CRZ5
ENSTNIP00000011029 99883.ENSTNIP00000011029 ENSTNIP00000011029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]