SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011095 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011095
Domain Number 1 Region: 9-123
Classification Level Classification E-value
Superfamily SH2 domain 9.02e-24
Family SH2 domain 0.00049
Further Details:      
 
Domain Number 2 Region: 380-556
Classification Level Classification E-value
Superfamily Ras GEF 1.44e-20
Family Ras GEF 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011095   Gene: ENSTNIG00000008265   Transcript: ENSTNIT00000011277
Sequence length 680
Comment pep:novel chromosome:TETRAODON8:18:9571965:9575851:1 gene:ENSTNIG00000008265 transcript:ENSTNIT00000011277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKKELEEELKLSSEDLSSHAWYHGPLRREAAEALLERNGDFLVRDSSSTPRDYVLTCFWM
NMPMHFKIIRVVLRPKKGYSRELFQFEEDRFDNIPALIRLYVGGRRPISQASGAVISHPI
TRTLPLRVIREQQAVPDSKGAGSDKEAKSSKRRSLSTADTLQVINPLLRSGEACRNAYKY
RSGSQPANLENVGRRPSLQSAQSDSNIRTGTPQITRAEEPGPVPMSPVFRTGSEPMLSPR
HTRPSLPGGGVTLRGSDGQLHPRAPPKPLRVSAVFPNAVIPPPLQRKEDPSSFYDELVVQ
YHSLCLYKQRGLPVPQARHKSHVDRLRAEEKWQSRARLTETSFGFLEASSQPPLIPQKTE
QKVEDWHFQKPHVELESCFQLDRFDSLLLPQNNRPLEPSVLLVLKELFNRSNANATALHM
LSVDCQVVRITQVTEEQKTIMGVESGLELITLPHGRQLRLDLLERHHLLALGVAVDILGC
TGTVSQRAAVLHKIILLAQALKEHAHDLYSFSAVMKALEMPQVARLEMTWRALRQNHTEM
AVLFEKTLKPFMNLLNEGDNAAFDGPVAVPHLVPLLMAMEGDDPVENSERGCQLLYNILQ
CARNTAVHAHDYQQHANSLLTGWVPVPELLEVFRTEFALRLLWGQSGAAGDKRERYEKFD
KVLTVLSNKLEPVEIRTTQA
Download sequence
Identical sequences H3CS61
99883.ENSTNIP00000011095 ENSTNIP00000011095 ENSTNIP00000011095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]