SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011155 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011155
Domain Number 1 Region: 5-148
Classification Level Classification E-value
Superfamily EF-hand 3.29e-32
Family Calmodulin-like 0.00000667
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011155   Gene: ENSTNIG00000008325   Transcript: ENSTNIT00000011337
Sequence length 150
Comment pep:novel chromosome:TETRAODON8:3:2172574:2175296:-1 gene:ENSTNIG00000008325 transcript:ENSTNIT00000011337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEYTPDQIEDFKEAFGLFDRVGDNQVAYNQVADIMRALGQNPTNKDVTKILGNPSADDM
ANKRLNFDAFLPMLKEVDSLPKGTVDDYVEGLRVFDKEGNGTVMGAELRIVLSTLGEKMS
EPEIEALMAGQEDENGSVHYEAFVKHIMSV
Download sequence
Identical sequences H3CSC1
ENSTNIP00000011155 99883.ENSTNIP00000011155 ENSTNIP00000011155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]