SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011261 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000011261
Domain Number - Region: 226-273
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000691
Family Laminin-type module 0.03
Further Details:      
 
Domain Number - Region: 6-55
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0061
Family Laminin-type module 0.044
Further Details:      
 
Domain Number - Region: 488-533
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0099
Family Laminin-type module 0.021
Further Details:      
 
Domain Number - Region: 355-404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0104
Family Laminin-type module 0.057
Further Details:      
 
Domain Number - Region: 574-607
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0191
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 402-447
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0293
Family Laminin-type module 0.054
Further Details:      
 
Domain Number - Region: 54-80
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0562
Family EGF-type module 0.073
Further Details:      
 
Domain Number - Region: 445-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0646
Family EGF-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011261   Gene: ENSTNIG00000008426   Transcript: ENSTNIT00000011443
Sequence length 908
Comment pep:novel chromosome:TETRAODON8:13:8004251:8022327:-1 gene:ENSTNIG00000008426 transcript:ENSTNIT00000011443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YWGPHCSNRCQCQNGAKCNPITGACVCTDGYQGWRCEEPCERGYYGKACQLPCQCLNGGT
CVHITGECICPAGYSGAFCGERCPTGSHGFHCEQNCPCQNGGTCHHITGDCSCPAGWTGS
VCTQPCPLGKYGINCSKDCSCRNGGVCDHVTGNCQCAAGFSGRRCQNDCPVGSFGLQCTP
KCECQNGAKCHHINGACLCETGFKGPNCQERFCPPGLYGLICDKYCPCNSTNTVSCHPLS
GECSCTGGWTGLYCNETCPAGYYGEACMLPCSCSNGADCHPVTGACVCAPGFMGEDCTTL
CYLSNEIPNAKNALNVFNIISVPLSPLHDLLYFSEGWQGVDCSIPCSSGTWGLGCNQTCL
CANGAACDPIDGICTCSPGWRGEHCDESCPDGTYGLECRERCDCSHADGCDPTSGYCRCY
PGWTGIHCDNVCPQGFWGPNCSFSCSCQNGGSCSPEDGTCVCAPGYRGTSCKRICPSGRY
GRACTEVCLCSNNGTCNPIDGSCQCVPGWIGEDCSQACPSGHWGPDCLNSCNCHNGAQCS
AYDGECRCSPGWNGLYCTQQCPAGTFGYGCQQLCECLNNATCDYVTGTCYCSPGYKGIRC
DQEELNPYTKISPARGSERQSAGAVMGIIFLLLIIMAMLSLFVWYRQRQRDKGHESQPSV
SYSQAMHLTNTDYSLSEVNQSQGSCNSGGQCYQTVAQCNVSTISSKLDGNQTLKVSAALS
RVFAGHVLNSVAATPNCTLPFTVKHPEKQERLRMEGLLQPQRYRGTHKHNEAPEKPFPAH
GPHYIKSSMCSNSSCSLNSENPYATIRDPPALACKHAENSYVEIKSPSHREVPFGGTATL
LGSAGRNVYDVESTTEPTVSVLQGPNGMATGFSQSPYDIPRGTHIPGHYDMPPMRHRPPN
TPPPPPES
Download sequence
Identical sequences H3CSM7
99883.ENSTNIP00000011261 ENSTNIP00000011261 ENSTNIP00000011261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]