SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011484 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011484
Domain Number 1 Region: 204-326
Classification Level Classification E-value
Superfamily EF-hand 1.21e-34
Family Osteonectin 0.014
Further Details:      
 
Domain Number 2 Region: 297-389
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.06e-21
Family Thyroglobulin type-1 domain 0.00091
Further Details:      
 
Domain Number 3 Region: 144-185
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000125
Family Ovomucoid domain III-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011484   Gene: ENSTNIG00000008637   Transcript: ENSTNIT00000011666
Sequence length 399
Comment pep:novel chromosome:TETRAODON8:17:6047642:6061213:1 gene:ENSTNIG00000008637 transcript:ENSTNIT00000011666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEMTDLACLLVPLVMLADAAFQTDLKSVKEAEKTGNFMEDEQWLSTISQYSRKIKHWNR
FRDEVEDDYVRTWDENQGSDDNVDTTKDPCQKIKCSRHKVCIAQGYQRAVCINRKKLEHR
QHSGQLVLHVQIAGLLMETVSPAPSPPWGPVCGSDGHNYASKCKLEQQACLSGKDLTLRC
AGLCPCTTAAPTPKFFTPLASTESCTGQDLADLGERLRDWFQLLQTNAKQSNNSKPGARA
AAASTTSVLDRSLVASCKDSIGWMFSKLDTNGDLYLDQAELAAINLDKYEVCIRPFFNSC
DSYKDGKVSTAEWCLCFWREKPPCLTELERIQILDGGKRKYVQGQFISSCDEDGFYRKLQ
CDRGECWCVDQNGGEVAGTRTRGKTDCDDEMAYSGDTGS
Download sequence
Identical sequences H3CTA0
ENSTNIP00000011484 ENSTNIP00000011484 99883.ENSTNIP00000011484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]