SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011569 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011569
Domain Number 1 Region: 138-380
Classification Level Classification E-value
Superfamily vWA-like 6.74e-85
Family Integrin A (or I) domain 0.000000212
Further Details:      
 
Domain Number 2 Region: 359-469
Classification Level Classification E-value
Superfamily Integrin domains 1.2e-21
Family Integrin domains 0.00076
Further Details:      
 
Domain Number 3 Region: 638-727
Classification Level Classification E-value
Superfamily Integrin beta tail domain 3.53e-20
Family Integrin beta tail domain 0.0021
Further Details:      
 
Domain Number 4 Region: 26-84
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000068
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 5 Region: 595-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000614
Family Integrin beta EGF-like domains 0.0029
Further Details:      
 
Domain Number 6 Region: 554-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000137
Family Integrin beta EGF-like domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011569   Gene: ENSTNIG00000008718   Transcript: ENSTNIT00000011751
Sequence length 799
Comment pep:novel chromosome:TETRAODON8:Un_random:89936371:89942786:-1 gene:ENSTNIG00000008718 transcript:ENSTNIT00000011751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMDLRLLLLSILLGSFCDSFAQKEGNECISAKAEYCGKCIQAGAKCGWCKDPAFLKQGEA
VSTRCDELESLVKRGCLVHMIESPKGGWVTVKNKTVTNRKKGGQKLKPEDITQIQPQKLK
LTLRSGEPQTFDLKFKRAEDYPIDLYYLMDLSYSMEDDLENVKNLGTSLMLEMSKITSDF
RIGFGSFVEKTVMPYISTTPAKLLNPCSNDKNCTSPFSYKNVLNLTSDGTRFNTLVGQQQ
ISGNLDSPEGGFDAIMQVAVCVDQIGWRDVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGK
CHLENNVYTMSHYYDYPSIAHLVQKLSDNNIQTIFAVTEEFQPVYQELKNLIPKSAVGTL
SANSSNVINLIIDAYNSLSSEVILENSKLPEGVTVAYTSHCKNGVVNKGENGRKCSNISI
GDEVTFTISVTSTGCPKQGKPETIKIKPLGFREELEITLNFICECECHKDGIVNSSQCHS
NGTYECGDCKCNEGRVGRECECSSNDVATEDMDRTCRKDNTTDICSNNGDCVCGRCECKN
RDNPEERYSGKFCECDNFSCDRSSNKLCGGHGRCECRVCICDPMWIGSACDCSLDNNSCI
ASNKQLCNGRGKCECGSCKCTDPKFQGPTCEICPTCPGVCTEHKECVQCRTFGTGEKKDT
CEKECSYFNLIKVKDRDKLPQPNDAAYPVMHCKERDANDCWFYYTYAVNNSTQKEVHVVD
SLDCPAGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGE
NPIYKSAVTTVVNPKYEGK
Download sequence
Identical sequences H3CTI5
ENSTNIP00000011569 99883.ENSTNIP00000011569 ENSTNIP00000011569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]