SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011609 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011609
Domain Number 1 Region: 291-579
Classification Level Classification E-value
Superfamily BEACH domain 6.8e-115
Family BEACH domain 0.0000000975
Further Details:      
 
Domain Number 2 Region: 627-924
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.78e-54
Family WD40-repeat 0.00082
Further Details:      
 
Domain Number 3 Region: 195-288
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000615
Family PreBEACH PH-like domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011609   Gene: ENSTNIG00000008761   Transcript: ENSTNIT00000011796
Sequence length 926
Comment pep:novel chromosome:TETRAODON8:Un_random:91031256:91037791:1 gene:ENSTNIG00000008761 transcript:ENSTNIT00000011796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFLQRQERNKESLIMQITVKHIFSLLLLDLEEYYFEQHTAHRISSSSRKDKGRKVRGSL
KICSRSIIFDPDDFKEPILKIPLRDCSRIELVEEENNPFAERRPPAVCVLSAQVIFIKEG
NIIGPYRNERGSQKWTFQLEVYSKTEDVVQTLLQLHRASCLEKLGDQAAMIAANLQSRLA
RTSFDKNCFQSVCERPHLECAAEMVLPLVCNPGHVCITDESLYFQPLNGYPEQVIHIKLH
AVRRIYKRRHGLRPLTQGLEVFCTENDFCSDIYLKFYSPADRDEVYGYTATFLENHVTEH
TAESYMLQWQRGLLSNYQYLLHLNNLADRSCNDLSQYPVLPWIIADYSSGQLDMTNPATF
RDLSKPVGALNPERLDRLLSRYTAMPEPRFMYGSHYSSPGYVLFYLVRVAPEHMLCLQNG
RYDHPDRMFSSISETWKNCLEGATDFKELIPEFFGDDSSFLENKLRLDLGRKQSGSFVGD
VVLPPWASDFGDFLQKHRSALESQLVSENLHQWIDLVFGYKQRGSHAVAAHNVFHPLTYE
GSVDCESIEDPDQRIAMLTQILEFGQTPRQLFSSPHPQRMAPRFLAMTRSPSSGSAASEL
CPASPCGDSSFEDLTEESRRLGWANMGNLEPVHRHRVHKEAVTGIAVTRDGSAVFSTSQD
STLKMFSREMKDFQRSMSFSNMALSSCLMLAEDETVACSSWDNNIYFYSVPYGRRLDTLM
GHDDAVSQMCWCEERLYSASWDSTVKVWRCPSMNSSSHRRSQFELLAELEHDSGVNTLSL
TAAGTLLVSGCKDGTVSIWDADSYASLQQVHCHDGTVHHAAFSPDSRHVLSAAADSCMKV
TDVQTGMVMSSVKAEEEQRCFCWDGSSVLCGGQSGDLLLWDLLSNTITRRIPAHSGAVTA
IWMNELCATVITGGEDGQTIFWRLHS
Download sequence
Identical sequences H3CTM5
ENSTNIP00000011609 ENSTNIP00000011609 99883.ENSTNIP00000011609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]