SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011630 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011630
Domain Number 1 Region: 1028-1143
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.61e-17
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0046
Further Details:      
 
Domain Number 2 Region: 341-381
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000101
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 556-595
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000012
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 4 Region: 258-294
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 5 Region: 384-423
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 6 Region: 158-221
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000213
Family ATI-like 0.024
Further Details:      
 
Domain Number 7 Region: 443-480
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 661-710
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000889
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 9 Region: 480-519
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000038
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 10 Region: 298-337
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000877
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 11 Region: 873-931
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000262
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 12 Region: 771-835
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000105
Family ATI-like 0.056
Further Details:      
 
Domain Number 13 Region: 710-765
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000262
Family TSP-1 type 1 repeat 0.00096
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000011630
Domain Number - Region: 929-992
Classification Level Classification E-value
Superfamily FnI-like domain 0.000167
Family VWC domain 0.063
Further Details:      
 
Domain Number - Region: 609-645
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000851
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011630   Gene: ENSTNIG00000008781   Transcript: ENSTNIT00000011818
Sequence length 1154
Comment pep:novel chromosome:TETRAODON8:Un_random:91352857:91360341:1 gene:ENSTNIG00000008781 transcript:ENSTNIT00000011818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVQHLFVCALSPGMRVYVRLAAFLHGQVGGLCGNFDGDTENDFTTRQGIIESTAELFGNS
WKVSPSCPDVADQDLRDPCALNPHRVTWARKKCAILTQELFSQCHFEVSFQQYYEWCVFD
ACGCDSGGDCECLCTAIAAYAEECNRRGVYVRWRSQELCPLQCENGLVYDPCGPACSPSC
PHVQQGPDSQCGAFSCVEGCFCPSGMVLNGELCVDPPQCPCEWEGSVFPSGAIIAQHCQN
CSCVEGLWQCEGVPCHPPSPACLETEFTCAGGRCIPSQWVCDNEDDCGDGSDEVCLSPCA
PDEFQCSSTPSGPCLKLALRCNGQPDCADHSDEEFCGPATPTPLCPPGEFQCASGRCLPA
SRVCDGRLDCGFADGSDERDCGVVCDKGEFLCSGGRCILYLHRCDGHDDCGDLSDERGYA
CVVQHFSFKPIFKKILIVFKRCVCAPGEFQCPDDKCVSASRVCDGHTDCPTGTDEAICPR
PALPDQFACSDSTCISTNMLCDGATDCPGGEDENRTACTTVSKTPSPSVTATVQTSGICG
SSYMNFYYSELLSSFFSPACRSYEFSCDSGAQCVPQAWHCDGETDCLDGSDERQCADKIV
PPPGSRNATVPCTEFTCLDGSCIPFNMASPRLYQVCNGVADCQDSTLAPLGGPTDEEGCR
SWSPWGHWSPCSASCGTGSMSRQRHCPPGSPLHRCAGEAIQKQQCFNTTCPVDGQWLPWL
DWSNCSSCGGVQVRHRGCVPPRYGGRHCSQLPGPSNLTMEIKQCPDVGCANTSCPPGLLR
YLCAPCPVSCAHISTGTICSPSPVPCSSVFVTPGCWCPEGLVMNHLQQCVLPKECVCEVA
GVRYWPGQHMKVGCEICVCERGKPQRCQPNADCSVNCGWSAWSDWGECLGPCGVQSIQWS
FRSPNNPTKRGEGKTCRGIYRKARRCQTEPCEECEFQGRSHPVGDRWTSDRCQLCYCLSN
LTVQCAPFCPHAVSGCPQGQTLVPGEKDRCCYCKGENDTVVTVTPVTSKPEDGTSPLVPS
YPLPPRDDCWAPLGVQFLPDSSFSASSQQAGHPPEAGRLHGWNPHRDLQGWSPEPENYKD
LPQRRPDGQTSSTQSPYVQIDLLRFHNITGVLTQGGGVFGTFVSSFYLQFSQDGRRWYTY
KELVAQAQPRAKVS
Download sequence
Identical sequences H3CTP6
99883.ENSTNIP00000011630 ENSTNIP00000011630 ENSTNIP00000011630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]