SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011671 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011671
Domain Number 1 Region: 25-61
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000297
Family EGF-type module 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011671   Gene: ENSTNIG00000008820   Transcript: ENSTNIT00000011859
Sequence length 400
Comment pep:novel chromosome:TETRAODON8:13:1438891:1441707:1 gene:ENSTNIG00000008820 transcript:ENSTNIT00000011859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFIAVKRSALLVLFLGFVFHRVEGICSVQNCTDSSRCVLSKDQRSCKCITGYYGDHCDK
NADIKVLCSADVLGIRAKEDFFIYHNVSLEYLHQPNDTCRALKTTINNVTYYASRISKEN
YFTCGGRPLEKNITHITYSLSLVSQPQVYRNIIRNPVIRLEYKCVFPYVRKVSLPFPIIP
YSIETLVRVDDLDAAIRMMLYTDHTYSEAYHSAPSIELRSKVYVEVKVTEPADFFLLRLN
KCWATQTPQPNTTEGAYHLLLQNGCADDHTVSFLADDVGQYGSNGEGSTVRYSFEMFRFT
TEPLELYLHCSVQLCAPDDPESCKPNCNSISKREAVRARPIQGLLTYGPIKVDMPGMSQP
NMWMTVVLPVAAIWMLGLFFLILIAVAKAGSRRLTKKPAC
Download sequence
Identical sequences Q4SKD1
99883.ENSTNIP00000011671 ENSTNIP00000011671 ENSTNIP00000011671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]