SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011676 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011676
Domain Number 1 Region: 332-501
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-30
Family SPRY domain 0.06
Further Details:      
 
Domain Number 2 Region: 532-583
Classification Level Classification E-value
Superfamily RING/U-box 0.00000489
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000011676
Domain Number - Region: 170-303
Classification Level Classification E-value
Superfamily ARM repeat 0.0012
Family Armadillo repeat 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011676   Gene: ENSTNIG00000008825   Transcript: ENSTNIT00000011864
Sequence length 591
Comment pep:novel chromosome:TETRAODON8:13:1397979:1403283:-1 gene:ENSTNIG00000008825 transcript:ENSTNIT00000011864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVTAWITFCACRSLAKVLLYLSLSNSVPTAWETFASVVSSTGTMGNSCVCREDSDLEDH
QHGSSRATRGQARRLDRGTRVVVDAGEARTSRPRDPVRPPRRGRGPHEPRRKKQNVDSLV
LDTLAVIRTLVDNDQEPPYSMITLHEMAETDDGWLEVVQSLIRVIPLDDPLGPAVITLLL
DECPLPTKDALQKLSDMLCLSSAVARQDALSPAKHRNTTAVLGCLAEKLAGPASIGLLSP
GTLDYLLESLSSEAHPTVMLFALIALEKFSQTSENKLTVSESSISSRLAVLELWADPDYL
KRQVGFCSQWSLDNLFLKEGRQFTYEKVNLANVNAMLNSNDVSEYLKISPTGLEARCDAS
SFESVRCTFCVDSGVWYYEVTVITSGVMQIGWATKDSKFLNHEGYGIGDDEYSCAYDGCR
QLIWYNARSKPHPHPCWKEGDAIGFLLDLSKKQMIFYLNGHQLPPEKQVFSSATSGFFAA
ASFMSYQQCEFNFGAKPFRHPPPVKFSTFNDLASLQPSEKIILPRHRRLALLKQVSIRDN
CCTLCCDVMADTELRPCGHGGMCMECALQLETCPLCRQDIQTRVRLIAHVS
Download sequence
Identical sequences H3CTU2
ENSTNIP00000011676 99883.ENSTNIP00000011676 ENSTNIP00000011676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]