SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011726 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011726
Domain Number 1 Region: 1112-1281
Classification Level Classification E-value
Superfamily C-type lectin-like 5.65e-73
Family Endostatin 0.00000152
Further Details:      
 
Domain Number 2 Region: 27-226
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.64e-31
Family Laminin G-like module 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011726   Gene: ENSTNIG00000008873   Transcript: ENSTNIT00000011914
Sequence length 1286
Comment pep:novel chromosome:TETRAODON8:2:18898860:18915763:1 gene:ENSTNIG00000008873 transcript:ENSTNIT00000011914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYNRLDISAFLPFSTLLRSKSSHPEDSGVSLLQLIGDPPPPEITQVDGPDNSPAYVFGTD
ANTGQLARAHLPNPFYRDFALIFHLKSSSNKGGVVFSITDASQRIMYVGVKLSDVQGGKQ
NVILFYTEPDSEQSYEAARFPVPSTVDTWTRFAIAVRDETVMFYLNCEAGPQVMRIERSP
DDMELEAGAGVFIGQAGGADPGKFLGVIGELRVVGDPRAAERYCEEDGDDSDMASGEGSG
YEESRPSKPHVEKHRWTTTPSSSRPIQQPPLSTKDEMLREKGEFTPIKRIAPETAPGLRT
IGAKGEKGDQGQRGDFRGGVRGEKKGEPGPPGPPGPSGPPGPAHNSVGCKGGSAGNTCLQ
GPPGIDGEPGDPGEDGKPGPVGPPGFPGTPGDQGPKGEKGDTGEGPPGPRGPPGPPGPPG
PGSRSVSQSTFVDMEGSGFPDLESLRGPPGLPGLPGPPGPPGPATAVTGLGSGATGSPGK
DGAPGQPGLPGIPGTDGLPGPTGPRGEKVNSAVKIPKGDSGELGLPGAVGQKGEQGSPGL
PGNPGEAGLAGLPGPRGPMGLPGPPGPPGPGFRVGFDDMEGSGGGFHQQPGVRGPEGKQG
PPGFPGLPGKPGFPGPPGPKGNTGPGGKDGQPGLDGFPGPQGPKGFQGDKGDRGEAGQDG
IGLPGPPGPPGPPGEIIYRSSGNVDGAIGSVGPQGLPGQPGFPGPAGPKGDAGEPGLPGL
AVKGEKGEPGLVVGPDGSQLSLEGLTGLKGERGLPGPVGPPGSFGPPGFKGEIGMPGRPG
RPGINGYKGEKGEPGTGSGFGYPGPPGPPGPPGPPGPSIPLDRFNVSTQNAPLDLNNKDT
VKGEKGERGDQGLPGIPGTASNFDIYAFKNELKGEHGDQGLKGEKGEPGGYYDPRFGAVQ
GPPGNPGLPGPKGDSIIGPIGPQGPPGQPGIGYDGPAGPPGPPGPPGAPGTGTYNYPVTV
TGPPGPPGPPGIPGESSGVTVLRSYDTMIATARHQPEGSLIYIVDKGDLYLRVRYGLRQV
MVNRFTHLYLLKENEVAEAQPPPVILYPHSQEQSHNNGAGHYSQGEPVIQPIEPPPQPPV
NGNKNRHTVTPHRPPNPPVLQPLGNVETSATALHLIALNAPQTGNMRGIRGADFLCFQQA
RAIGLKGTFRAFLSSKLQDLYTIVRRSDRDNFPIVNLKDQVLFRSWESMFGDDASKIMEN
VPIYSFDGRDILRDSAWPEKMVWHGSSNKGHRQTDQYCETWRAGDRAVTGLASSLKSGYL
LQQSASSCSGSYIVLCIENAFTSHSK
Download sequence
Identical sequences H3CTZ2
ENSTNIP00000011726 ENSTNIP00000011726 99883.ENSTNIP00000011726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]