SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011853 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011853
Domain Number 1 Region: 25-68
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000016
Family EGF-type module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011853   Gene: ENSTNIG00000008999   Transcript: ENSTNIT00000012043
Sequence length 128
Comment pep:novel chromosome:TETRAODON8:1:2432375:2432963:1 gene:ENSTNIG00000008999 transcript:ENSTNIT00000012043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAERTEERTRKGKGKVRGKGKGRKRNACLKKYKDFCIHGTCQYLRNVRAPSCVCHKSYSG
DRCQFFTLPMEKPQGSYNRTTALAVVAVVLSSLCLIIIGLLLLLRFHKRGAYDVENEEKV
KLGLVSNH
Download sequence
Identical sequences H3CUB9
ENSTNIP00000011853 99883.ENSTNIP00000011853 ENSTNIP00000011853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]