SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011884 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011884
Domain Number 1 Region: 7-169
Classification Level Classification E-value
Superfamily Sec7 domain 1.44e-50
Family Sec7 domain 0.00011
Further Details:      
 
Domain Number 2 Region: 205-335
Classification Level Classification E-value
Superfamily PH domain-like 9.04e-25
Family Pleckstrin-homology domain (PH domain) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011884   Gene: ENSTNIG00000009028   Transcript: ENSTNIT00000012074
Sequence length 462
Comment pep:novel chromosome:TETRAODON8:4:2772588:2775171:-1 gene:ENSTNIG00000009028 transcript:ENSTNIT00000012074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NGCEVDGEKVRGLAQRLFKLDGFQRVDVVKHLDKDNDFSRAVGEEYLKFFDFAGQPLDGA
LRSFLKVVVLIGETQERERVLQHFSCRFHQCNPGCFCSSGAVLALTCALMLLNTDLHGQQ
NVGKSMSSSKFVSNLDGMNEGKNFNKNLLKGLYNSIKTDPLEWAVDEGELMSSVYVDGEA
GNGAPLRSKTNPFLDVPHDKKASEVKDGILQRKLHADIDGKRIPWGKRGWKTFHGVLKGM
VLYLQKVDYRRDQLVNEEVVSVHHSLAEPAVDYTKKPHVFRLQTADWRVFLFQASGKVEM
NSWISRINLASALQSSQPFPAAVGSQRKFFRPILPALQSAHTLERQLQSHLGMLESFKAD
ISYMQKNLPEHKKAKAKELEEHRIRAEYLHYEMRRYEIYIQVLEAWKSIKKGDEDEEEGL
QKSHSSPALPELPPQTVIKVKRNISERRTYRRVIVPRLNKEA
Download sequence
Identical sequences H3CUF0
99883.ENSTNIP00000011884 ENSTNIP00000011884 ENSTNIP00000011884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]