SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011929 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011929
Domain Number 1 Region: 699-756
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000709
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 2 Region: 11-51
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000262
Family Somatomedin B domain 0.0034
Further Details:      
 
Domain Number 3 Region: 46-117
Classification Level Classification E-value
Superfamily E set domains 0.000035
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011929   Gene: ENSTNIG00000009070   Transcript: ENSTNIT00000012119
Sequence length 797
Comment pep:novel chromosome:TETRAODON8:4:1988630:1993522:1 gene:ENSTNIG00000009070 transcript:ENSTNIT00000012119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGPSPQEGARNTCEGKCGKSVPTCSCEPTCRSLKTCCPDYAEFCVEISPYSGSIMGGTEF
VVLNVTFSNTSGLMCRFHNNTVTEGYVDGHGRGHCVSPLLYRTGLVSLEISYNGSAFNRA
GTWLSVHSGKLDSKFKAAMVNSTQWQYYGTPNVSGTLEMTWNPSLVRGNKVNIELWGYRE
TGDPYGENWQAEWKYLYTLAKDQPNNGSFSFVPKPAQSGFSSWELGSLRVSSSIHGEGKR
DVQAVWTEDHALAWHLEEKFRQDSTAWALDKCLAWDRLEEKLPSFIQELIDCPCTLAQAR
ADTGRFHTDYGCDIEKGSVCTYHPGCVHCVRAIQASPLRGAGQQCCYDSNGTQVLTGDSI
GGSTPDRAHDWGSPPYDKPPHVPGQSHWLYDVLSFYYCCLWSDNCQYYFKHRPSSDCTRY
KSPSTAVVFGDPHFVTFDHASFSFNGKGEYNLMTSEKNLTIQGRTEPMNATIKATKLTSV
AMKESNFDTVEVRVASDQSSLEVLRNHKSLSFSEQSWMDLTGVSVFSPSPTNVTVMFRSG
AGVEVRLREGTMTTTVLLPKSFTNTTSGLLGRMNDDLSDDLTFNNGQVVQNLSNPEEVFS
FGASCAITAASSLFTYDSKYLLDTYASGPKHHVNFIPVFSIPENPNDPLANQTSEICSGE
GWQFCRYDILVGRNPSLGNATRAAFQSHISLLKALRSVVACGYIAAPTNGKKVGSSYLQG
AKLQFSCNDGYALRGSQERVCQENGQWSGETVRCEHPSTGIIAGSVIGGIALILIITMSV
LYYKKLSAKSVLWSPHP
Download sequence
Identical sequences H3CUJ5
99883.ENSTNIP00000011929 ENSTNIP00000011929 ENSTNIP00000011929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]