SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011951 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011951
Domain Number 1 Region: 102-269
Classification Level Classification E-value
Superfamily C-type lectin-like 2.58e-20
Family C-type lectin domain 0.0028
Further Details:      
 
Domain Number 2 Region: 39-79
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000327
Family LDL receptor-like module 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000011951
Domain Number - Region: 263-328
Classification Level Classification E-value
Superfamily FnI-like domain 0.000418
Family VWC domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011951   Gene: ENSTNIG00000009092   Transcript: ENSTNIT00000012141
Sequence length 532
Comment pep:novel chromosome:TETRAODON8:4:1786022:1791730:1 gene:ENSTNIG00000009092 transcript:ENSTNIT00000012141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPKARSRSFVLFSLLFVLTVTDPPRTGPRLAMARLLSEQRCSLGQFACRSGKMQCIPIS
WQCDGWTACDDKSDELDCPPMKEERYRYGNGYDQVEDVIGVAQPVRFNKKCPSGWHHYEK
TASCYKVYLRSENYWQAVETCQKVNGSLATFVTNEELQFILKIEVDFDDKVCDRRDQCKF
WVGYQYVITNQNHSLEGRWEVAYQGSMQVFLPPEGLTNFGEASSTQDSVFCAQLQRFQIK
SMNERGLHSWHAENCYKKFPFLCKRRQTCVDIKDNVVNEGYYFTPKGDDPCLSCTCHDGE
PEMCVAALCERPQGCQHFRKDPKECCKFTCLDPDGNSLFHSMASGMRLIVSCISSFLILS
LLLFMVHRLRQRRRERIETLIGGNLHHFNLGRHVPGFDYGPDVFGTGLTPLHLSDDGEGG
AFHFQEPPPPYAAYKYPDIHHPDDPPPPYEASINPDSLLYVDLGHRSISLAPNQMNGADL
QADISTPCPLSESAPPPQEREDSIDSSTLLVGPDTPVDGQAPDCASSLSTVV
Download sequence
Identical sequences H3CUL7
ENSTNIP00000011951 99883.ENSTNIP00000011951 ENSTNIP00000011951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]