SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011959 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011959
Domain Number 1 Region: 111-305
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.67e-58
Family Astacin 0.0001
Further Details:      
 
Domain Number 2 Region: 732-844
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-39
Family Spermadhesin, CUB domain 0.00019
Further Details:      
 
Domain Number 3 Region: 428-530
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-36
Family Spermadhesin, CUB domain 0.00031
Further Details:      
 
Domain Number 4 Region: 312-421
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-35
Family Spermadhesin, CUB domain 0.00065
Further Details:      
 
Domain Number 5 Region: 578-688
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-34
Family Spermadhesin, CUB domain 0.0004
Further Details:      
 
Domain Number 6 Region: 868-960
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-29
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 7 Region: 532-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000061
Family EGF-type module 0.007
Further Details:      
 
Domain Number 8 Region: 686-729
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000172
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011959   Gene: ENSTNIG00000009100   Transcript: ENSTNIT00000012149
Sequence length 972
Comment pep:novel chromosome:TETRAODON8:4:1729771:1736281:-1 gene:ENSTNIG00000009100 transcript:ENSTNIT00000012149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVAPAVALLLCVSLRLSLAAQLEFVDTNFTLVDEAIDYKDPCKAAAFWGDIALDEEDLR
MFRDLREDDQTSVHTSDSDSGDASSSSGGTRSRRAAAPQKLPRRRRAATSRPERMWPDGI
IPYVISGNFSGSQRAIFRQAMRHWEKHTCVAFTERTAEESYIVFTYRPCGCCSYVGRRGG
GPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDEHVSIIRDNIQQGQEYNFLKMEP
DEVDSLGEVYDFGSIMHYARNTFSRGVFLDTILPRYEVNGERPPIGQRTKLSKGDIAQAR
KLYKCAKCGENLQDSSGNFSSPGFPNGYSAYAHCVWRISVTPGEKIVLNFTSMDVFRSHL
CWYDHVEVRDGFWRKAPLKGRFCGDALPNPVVSTDSQLWIEFRSSSSWVGKGFSAVYEAI
CGGEVRRDSGQIQSPNYPDDYQSNKVCVWKITVEEGFSVGLSFQSFEIELHNSCAYDYVE
VRDGGSESSPLLGRFCGYEKPDDVNSSSNQLWLTFVSDGSVNKARFAANFFKEMDECSRP
DNGHCQQRCLNTLGSYRCACDPGYELAADRRSCETAACGGFVAKLNGSLATPGWPKDYPP
NKNCVWQLMAPLQYRITLVFDAFETEGNDVCKYDYVEVRSGLTSDSKLHGKFCGAEKPEV
ITSQHNNMRIEFKSDSTVSKKGFRAHFFSDIDECSKENGGCQECVNTFGSYSCQCRSGFV
LHDNKHDCQPAGCDHVLNSVSGTISSPNWPDRYPSKKACTWALATTPGHRVRLVFNEVDM
EAHLECAYDHLEVYDGRDGRSPSLGRFCGTKKPPPVVSSGNRMFLRFFSDNSVQKRGFEA
SYEAECGGSLKAEVRTKELYSHAQFGDNNYPSGSDCLWVVSAEKGYGVEIVFQVFEIEEE
ADCSYDYVELYDGADVKAPRLGRYCGSGTPEEIYSAGDALVLKFHSDDSINRKGFHVRYT
GTKFQDTLHASK
Download sequence
Identical sequences H3CUM5
ENSTNIP00000011959 99883.ENSTNIP00000011959 ENSTNIP00000011959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]