SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012054 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012054
Domain Number 1 Region: 96-199
Classification Level Classification E-value
Superfamily TAFH domain-like 3.01e-39
Family TAFH domain-like 0.0000015
Further Details:      
 
Domain Number 2 Region: 493-536
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000000837
Family MYND zinc finger 0.00021
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000012054
Domain Number - Region: 428-500
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 0.0102
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012054   Gene: ENSTNIG00000009194   Transcript: ENSTNIT00000012245
Sequence length 601
Comment pep:novel chromosome:TETRAODON8:21:2814644:2826016:1 gene:ENSTNIG00000009194 transcript:ENSTNIT00000012245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCFPSDRTGKPSTMPDSPADVKTQSRLTPPTMPPPPSTQGAPRNSSYTPTTLTNGSSHSP
TALNGAPSPPNGYSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEI
GERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKGNLPLLQRELLHCARLAK
QNPAQYLAQHEQLLLDTSTTSPVDSSELLLDVNENGKRRTPDRTKENGFERDGTLHPDVH
PSKRPCTISPGQRFSPSNGLSYQPNGLPHPGPLPQQHYRLDDMAIAHHYRDSYRHPASNH
REIRERARPLVLLGGREDRKEARGTGATGRGTGQRAGHPPPPQRLNCIMDMVEKTRRSLT
VLRRCQEADREELNYWIRRYSDAEELKKGATSGQSRQQSPAVQENAPSEIHRELLHRPVS
GYVPEEIWKKAEEAVNEVKRQAMSELQKAVSEAERKAHEMISSERAKMERTVAEAKRQAA
EDALIIINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHVCGQTLQAQ
QQQAGQQQGSVPGSETPAPISSSACTPSSGTGSPAATPPAATPRSSTPSTPSSAALDGTP
R
Download sequence
Identical sequences H3CUX0
ENSTNIP00000012054 ENSTNIP00000012054 99883.ENSTNIP00000012054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]