SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012078 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012078
Domain Number 1 Region: 89-143
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000196
Family TSP-1 type 1 repeat 0.00081
Further Details:      
 
Domain Number 2 Region: 142-198
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000549
Family TSP-1 type 1 repeat 0.00068
Further Details:      
 
Domain Number 3 Region: 38-84
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000549
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 4 Region: 202-254
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000107
Family TSP-1 type 1 repeat 0.0009
Further Details:      
 
Domain Number 5 Region: 269-318
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0000942
Family Hormone receptor domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012078   Gene: ENSTNIG00000009216   Transcript: ENSTNIT00000012269
Sequence length 587
Comment pep:novel chromosome:TETRAODON8:21:3502103:3520014:1 gene:ENSTNIG00000009216 transcript:ENSTNIT00000012269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFLTFPFSDPYDDDLKVKTQRPRSADQPGVFQAQTGDPAAEEWSQWSVCSLTCGQGWQVR
TRSCVSSPYGTLCSGALRETRMCNNTSSCPVHGLWEEWSLWSLCSVTCGRGSRTRSRSCV
NGSGVLACRRPEIQTKLCNIAVCPVEGQWLEWGPWSRCSVTCDSGTQQRQRRCSSSVHGW
AECKGLHQESRECTNPSCSAGGGNWGSWNHWSLCSKTCDSGWQRRFRLCEATGLQGYPCD
GSGEEVRSCNEKKCPAPHEICKEEHLLAMSWKRASAGETVYNKCPTNATGSASRRCMLTN
NGVAFWGPPSFARCISLEYRYLHLSLREHLAKGQRTLAGEGMSQIVRSLLELLQRRSYYS
GDLLFSTEILRNVTDTFKRATYIPAPDDVQKFFQIVSHMLDMENLEKWEDVHQVAPGAAL
LMRILEDFIHLIGEAQKPFQSFLVVTNNLMITIQREPVSAVSSDINFPMKGRRGMKDWAR
TAEDKLYIPKEVFTNPTDGTEAGATSQIAKGREVFLLLWQTVLACVSGAEVDSESTMHYV
IGAILYRTLGLILPAPSAPAVINSKILTVTVRPEPQPSEPMVVVELS
Download sequence
Identical sequences H3CUZ4
ENSTNIP00000012078 ENSTNIP00000012078 99883.ENSTNIP00000012078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]