SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012159 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012159
Domain Number 1 Region: 80-147
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000153
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 136-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000913
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 3 Region: 241-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000816
Family EGF-type module 0.014
Further Details:      
 
Domain Number 4 Region: 194-235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000122
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000012159
Domain Number - Region: 276-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000239
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012159   Gene: ENSTNIG00000009293   Transcript: ENSTNIT00000012350
Sequence length 438
Comment pep:novel chromosome:TETRAODON8:5:5087396:5090003:1 gene:ENSTNIG00000009293 transcript:ENSTNIT00000012350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDGAECAIKLLLNQIVTVGKHALQDCASRQEIQGSLKQVQKLLSAHEASYLQSLRNLRK
KINLMQSSATKQPPRATNSTCPKLEAPANGRKLGKSQSVGHEVHFLCDPGYELVGSESRV
CQESLTWSGQQTACRDINECVSSPCLNGGTCVDEVNQFSCVCSKGWSGPTCQTPLPTYAA
AAASTLPAATAGSHVRPSRCTLTQGATHCTCEPGYTILGRDSNVCTDIDECELFHNGQAG
RLCLHACVNTPGGYRCSCPAGYNLTRDGRSCKDIDECATRQNNCTKDQMCVNTHGGFQCL
CVECPKIPHATYVKTSPIRCERNPCPVDNRACSQAPNSFSYHYLAVVSNLSAPRVMFRVS
ALRPIGDTLRFSLLGGKQARRHFTVQRSDRVTGELMLVSPVQGPATLEAEVEMTELERRA
QLGRYITKVTMFVSQYDF
Download sequence
Identical sequences H3CV75
ENSTNIP00000012159 99883.ENSTNIP00000012159 ENSTNIP00000012159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]