SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012224 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012224
Domain Number 1 Region: 64-194
Classification Level Classification E-value
Superfamily C-type lectin-like 1.69e-31
Family C-type lectin domain 0.0000448
Further Details:      
 
Domain Number 2 Region: 44-70
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.00000000222
Family Triple coiled coil domain of C-type lectins 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012224   Gene: ENSTNIG00000009356   Transcript: ENSTNIT00000012415
Sequence length 197
Comment pep:novel chromosome:TETRAODON8:5:6154389:6155539:1 gene:ENSTNIG00000009356 transcript:ENSTNIT00000012415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLGLPVFLLFLCFSLLQLSSGRSSRTRKAISRRQAGEGDDVRSQIEKLWQEVNSLKEM
QALQTVCLRGIKANRKCYLTSEEAKHYHEANEDCIAQGGTLATPRDLLENNELRDYAKRS
APGSRDFWIGVADIVKEGQYVDVNSLPVSFFNWDRSKKQPTGTKRESCVALSVAAQGKWH
DEVCRHLKKYICEYVIP
Download sequence
Identical sequences H3CVE0
ENSTNIP00000012224 99883.ENSTNIP00000012224 ENSTNIP00000012224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]