SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012321 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012321
Domain Number 1 Region: 257-445
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-37
Family Laminin G-like module 0.000000623
Further Details:      
 
Domain Number 2 Region: 461-656
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.06e-30
Family Laminin G-like module 0.0000262
Further Details:      
 
Domain Number 3 Region: 43-95
Classification Level Classification E-value
Superfamily GLA-domain 4.71e-19
Family GLA-domain 0.00052
Further Details:      
 
Domain Number 4 Region: 156-202
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000209
Family EGF-type module 0.011
Further Details:      
 
Domain Number 5 Region: 190-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000628
Family EGF-type module 0.005
Further Details:      
 
Domain Number 6 Region: 114-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000304
Family EGF-type module 0.018
Further Details:      
 
Domain Number 7 Region: 233-259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000265
Family EGF-type module 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012321   Gene: ENSTNIG00000009449   Transcript: ENSTNIT00000012512
Sequence length 660
Comment pep:novel chromosome:TETRAODON8:5:8297288:8304474:1 gene:ENSTNIG00000009449 transcript:ENSTNIT00000012512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLTPTKSLSPAALLLLLAVRWSGGIVSLSPQEANQFLSRHRRANQVFEETKQGHLEREC
VEERCSKEEAREVFENDPETDYFFPKYLACVERFGDAERKKQDLITCVHKDIPDQCSPSP
CHPGGTVRCEDKKGDFLCHCFTGWAGARCDTDVDECGKRNGGCDHRCNNTMGSYRCSCHQ
GYELHGRHTCADVDECKDPEVCGTARCQNKEGGYDCLCETGYVYDNETKSCLDVDECETG
VCAEVCLNIPGSFRCFCDGRQGRTLSQDLRSCKPLTPRLSPSLKKNSRSLYLGRMFSGVP
MVRLRFRRKIPTGFSAEFDFRTYDPEGVVFFAGGHLNSSWIVLAVHHGKLQLQLKYGSIS
RVTSSGPPINDGQWRKISVEEQGRSLVIKIDREAVMKIAVISNLFTLRKGVHELNFTVGG
VPFREDGLLYQVNPRLDGCMKEWKWLAGEDTSIQETIRSNDNMQCFSADDPGAYYPGTGF
ALFNTSYDEIPVSLPSESQNLSVRLSLRPTSAVGVLLALVHQDRVPLSIALVDYHPGTQE
WRDYILVTADDAIVASAPAPLCDGGSHQVHVTISGNQTLLLVDGQSGRRDDADVPTELLS
QSSTYIGGLPDVPLASTLVSAFYSGCMDVLINGQPVDLDQAVHKHNDIRSHSCPLLDSPQ
Download sequence
Identical sequences H3CVN7
99883.ENSTNIP00000012321 ENSTNIP00000012321 ENSTNIP00000012321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]