SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012483 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012483
Domain Number 1 Region: 441-697
Classification Level Classification E-value
Superfamily YWTD domain 1.05e-62
Family YWTD domain 0.00000077
Further Details:      
 
Domain Number 2 Region: 744-999
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-56
Family YWTD domain 0.00000169
Further Details:      
 
Domain Number 3 Region: 1356-1617
Classification Level Classification E-value
Superfamily YWTD domain 6.41e-51
Family YWTD domain 0.0000042
Further Details:      
 
Domain Number 4 Region: 1051-1303
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-50
Family YWTD domain 0.00000614
Further Details:      
 
Domain Number 5 Region: 264-304
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000785
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 6 Region: 354-433,689-738
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000581
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 7 Region: 228-266
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 8 Region: 143-183
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.00068
Further Details:      
 
Domain Number 9 Region: 310-346
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000537
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 10 Region: 68-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000733
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 11 Region: 105-142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 12 Region: 187-225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 13 Region: 1310-1356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000681
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 14 Region: 1004-1046
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000112
Family EGF-type module 0.011
Further Details:      
 
Domain Number 15 Region: 26-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.001
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000012483
Domain Number - Region: 1617-1654
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000157
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012483   Gene: ENSTNIG00000009608   Transcript: ENSTNIT00000012674
Sequence length 1926
Comment pep:novel chromosome:TETRAODON8:5:11802163:11833650:1 gene:ENSTNIG00000009608 transcript:ENSTNIT00000012674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSRSNSPLCLSAIHVIHGVRCSTECSCGRNHFTCAVSAFGECTCIPAQWQCDGDNDCGDH
SDEDGCMLPTCSPVDFHCDNGKCIRRSWLCDGDNDCEDDSDEQDCPPRECEEDEFQCQNG
YCIRSLWHCDGDNDCGDNSDEQCDMRKCSDKEFRCTDGSCIAEHWYCDGDTDCKDGSDEE
NCPSDVMAATCSVEEFQCAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSVEFMCSS
GMCINAGWRCDGEFDCDDQSDEKNCTTSMCTADQFRCGNGRCIRLSWRCDGEDDCADHSD
EEGCEKTESPPCAPDQFQCGNGRCIGQRKVCNEVNDCGDGTDEQPHHDCRPRSSEGNCNQ
NNGGCSQKCQMVRGLVQCTCHTGYRLMDDGKACQDVDECAEEGYCSQGCTNTEGAFQCWC
VQGYELRPDKRSCKALGPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHSQE
LVFWSDVTLDRIMKANLNGSNVEEVVSTGLESPGGLAIDWIHDKLYWTDSGTSRIEVANL
DGTHRKVLLWQNMEKPRAIALHPIEGKIYWTDWGNTPRIEYANMDGSNRRIIADTHLFWP
NGLTIDYAGRRMYWVDAKHHVIEKADLDGRNRKAVISHGLPHPFAITVFEDSLYWTDWHT
KSINSANKFTGKNQEIIRNKLHFPMDIHTLHPQRQPAGGRNRCGSNNGGCSHLCLPSNKT
YTCACPTGFKKVDHHNCADGLDKFLLFARRTDIRRISFDTEDMSDDVIPLADVRNAVALD
WDAKDGYIYWTDVTTDSINRALWNGTQQEVVVDTSLESPAGLAIDWVTSKLYWTDAGTDR
IEVSNADGSMRTVLIWENLDRPRDIVVDPIGGFMYWTDWGANPKIERAGMDASSRVVIIS
SNLTWPNGLAIDYDTKRLYWADAGMKTVEYGNFDGSGRQVLIGSQLPHPFGLTVHEDKLY
WTDWQSKSIQSADKLTGLGRQTLTENLENLMDIHMFHRQRETVHNPCLVNNGGCSHLCLL
APAPKASSCACPTGINLQTDGKTCTPGMSSFLIFARRTDIRMVSLDIPYFADVVLAVNTS
MKNTIAIGVDPKEGKVYWSDSTLKKISRASISGKAQEDIVSTGLMTTDGLAVDAVGRKIY
WTDTGTNRIEVANLDGSMRKILVWQNLDSPRAIALYNEMGYLYWTDWGEHAKLERSAMDG
SGRVVLISNNLGWPNGLAIDTAGSQLLWADAHTERIEAADLNGQNRRTLVTPVQHPYGLT
LLGSHIYWTDWQSRSIQRADKTTGTNTITVRSNLPGLMDIQAVDMERPLGFNKCGRRNGG
CTHLCLPRPNGTSCACPTGILLKGDGRSCDDSPETYLLFSNRISVRRISLDTNDHTDVHV
PVPELHNVISLDYDSVDGKLYYTDVTLDVIRRANLDGSGMETVISQGLKTTDGLAVDWVA
RNMYWTDTGRNTIEVARLDGTGRKVLINNSLDEPRAIAVFPSKGFLFLIDWGHIAKIERS
HLDGSDRKVLINTDLGWPNGLTLDYDTRRIFWVDAHLDRIESSDLNGKLRQILSKPVSSP
LTPFSRLSQQDRWIYWTDWQTKSIQRVDKHTGRNKETVLANVEGLMDIIVVSPHRQTGTN
LCGVNNGGCTHLCFAKTNSFVCACPDEPDGRPCSTSYVPTVPAGATSSTPVPNKIPNVPT
ETPRRGPTLVKKCNRTKSVTEHLKPSAFGFCSCTEKNLNEEGCLNSVVTAPHGEGLHISY
VIGGVLTILAILILIAALIIYRHKKSKFAEPGMSNLTYSNPSYRTSTQEVKIETSQKPPI
YNQLRYKKEQSIQGGVDGGYTKEKIRIVEGVCLLSNEELYWDDLKQIKPSRGGLHTCMRT
DTVSLQASSASLDDGETEQLLQEEASECSSITTLTPSAITPQRHSQHTLPDTGWASTRKP
STESEV
Download sequence
Identical sequences H3CW49
ENSTNIP00000012483 ENSTNIP00000012483 99883.ENSTNIP00000012483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]